KEGG   Arabidopsis thaliana (thale cress): AT3G25860Help
Entry
AT3G25860         CDS       T00041                                 

Gene name
LTA2
Definition
(RefSeq) 2-oxoacid dehydrogenases acyltransferase family protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00020  Citrate cycle (TCA cycle)
ath00620  Pyruvate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G25860 (LTA2)
   00020 Citrate cycle (TCA cycle)
    AT3G25860 (LTA2)
   00620 Pyruvate metabolism
    AT3G25860 (LTA2)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AT3G25860 (LTA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA
Motif
Other DBs
NCBI-GeneID: 822181
NCBI-ProteinID: NP_189215
MIPS: AT3G25860.1
TAIR: AT3G25860
Araport: AT3G25860
UniProt: Q9SQI8
LinkDB All DBs
Position
3
AA seq 480 aa AA seqDB search
MAVSSSSFLSTASLTNSKSNISFASSVSPSLRSVVFRSTTPATSHRRSMTVRSKIREIFM
PALSSTMTEGKIVSWIKTEGEKLAKGESVVVVESDKADMDVETFYDGYLAAIVVGEGETA
PVGAAIGLLAETEAEIEEAKSKAASKSSSSVAEAVVPSPPPVTSSPAPAIAQPAPVTAVS
DGPRKTVATPYAKKLAKQHKVDIESVAGTGPFGRITASDVETAAGIAPSKSSIAPPPPPP
PPVTAKATTTNLPPLLPDSSIVPFTAMQSAVSKNMIESLSVPTFRVGYPVNTDALDALYE
KVKPKGVTMTALLAKAAGMALAQHPVVNASCKDGKSFSYNSSINIAVAVAINGGLITPVL
QDADKLDLYLLSQKWKELVGKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGA
IMAVGASKPTVVADKDGFFSVKNTMLVNVTADHRIVYGADLAAFLQTFAKIIENPDSLTL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttcttcttcttcgtttctatcgacagcttcactaaccaattccaaatccaac
atttcattcgcttcctcagtatccccatccctccgcagcgtcgttttccgctccacgact
ccggcgacttctcaccgtcgttcaatgacggtccgatctaagattcgtgaaattttcatg
ccggcgttatcatcaaccatgacggaaggcaaaatcgtgtcatggatcaaaacagaaggc
gagaaactcgccaagggagagagtgttgtggttgttgaatctgataaagccgatatggat
gtagaaacgttttacgatggttatcttgctgcgattgtcgtcggagaaggtgaaacagct
ccggttggtgctgcgattggattgttagctgagactgaagctgagatcgaagaagctaag
agtaaagccgcttcgaaatcttcttcttctgtggctgaggctgtcgttccatctcctcct
ccggttacttcttctcctgctccggcgattgctcaaccggctccggtgacggcagtatca
gatggtccgaggaagactgttgcgacgccgtatgctaagaagcttgctaaacaacacaag
gttgatattgaatccgttgctggaactggaccattcggtaggattacggcttctgatgtg
gagacggcggctggaattgctccgtccaaatcctccatcgcaccaccgcctcctcctcca
cctccggtgacggctaaagcaaccaccactaatttgcctcctctgttacctgattcaagc
attgttcctttcacagcaatgcaatctgcagtatctaagaacatgattgagagtctctct
gttcctacattccgtgttggttatcctgtgaacactgacgctcttgatgcactttacgag
aaggtgaagccaaagggtgtaacaatgacagctttattagctaaagctgcagggatggcc
ttggctcagcatcctgtggtgaacgctagctgcaaagacgggaagagttttagttacaat
agtagcattaacattgcagtggcggttgctatcaatggtggcctgattacgcctgttcta
caagatgcagataagttggatttgtacttgttatctcaaaaatggaaagagctggtgggg
aaagctagaagcaagcaacttcaaccccatgaatacaactctggaacttttactttatcg
aatctcggtatgtttggagtggatagatttgacgctattcttccgccaggacagggtgct
attatggctgttggagcgtcaaagccaactgtagttgctgataaggatggattcttcagt
gtaaaaaacacaatgctggtgaatgtgactgcagatcatcgcattgtgtatggagctgac
ttggctgcttttctccaaacctttgcaaagatcattgagaatccagatagtttgacctta
taa

DBGET integrated database retrieval system