KEGG   Arabidopsis thaliana (thale cress): AT3G45940Help
Entry
AT3G45940         CDS       T00041                                 

Definition
(RefSeq) Glycosyl hydrolases family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AT3G45940
   00500 Starch and sucrose metabolism
    AT3G45940
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AT3G45940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 823737
NCBI-ProteinID: NP_190180
MIPS: AT3G45940.1
TAIR: AT3G45940
Araport: AT3G45940
UniProt: F4J6T7
LinkDB All DBs
Position
3
AA seq 868 aa AA seqDB search
MASCLSLLVAIILCFSSLQCSNAIGKGYRLISMEKSPDDGSFIGYLQVKQSNKIYGSDIT
ILRLFINYRTDHRLRVHITDAKKQRWEVPYNLLRREQPPNVIGKSRKSPVTVQEISGPEL
ILIFTVDPFSFAVRRRSNGETIFNTSSSDESFGEMVFKDQYLEISTSLPKDASLYGFGEN
SQANGIKLVPNEPYTLFTEDVSAFNLNTDLYGSHPVYMDLRNVSGKAYAHSVLLLNSHGM
DVFYRGDSLTYKVIGGVFDFYFFAGPSPLNVVDQYTSLIGRPAPMPYWSLGFHQCRWGYR
NVSVVKDVVDNYQKAKIPLDVIWNDADYMDGYKDFTLDLVNFPHAKLLSFLDRIHKMGMK
YVVIKDPGIGVNASYGVYQRGMASDVFIKYEGKPFLAQVWPGPVYFPDFLNPKTVSWWGD
EIRRFHELVPIDGLWIDMNEINATGHKASLGFKTIPTSAYHYNGVREYDAHSIYGFSEAI
ATHKALLAVQGKRPFILSRSTFVGSGQYAAHWTGDNQGTWQSLQVSISTMLNFGIFGVPM
VGSDICGFFPPTPEELCNRWIEVGAFYPFSRDHADYYAPRKELYQWGTVAESARNALGMR
YKLLPFLYTLNYEAHMSGAPIARPLFFSFPEFTECYGLSKQFLLGSSLMISPVLEQGKTQ
VEALFPPGSWYHMFDMTQVVVSKNGRLFTLPAPFNVVNVHLYQNAILPMQQVVAFPAGAS
EGYASGKLFLDDDELPEMKLGNGKSTYIDFYASVGNESVKIWSQVKEGQFALSQGLVIEK
VIVLGLKGTWKVSEILLNGSSISNETKTIEVSSKEQMYVVGSEDEGESKSFMVELKGLEM
LVGKDFNISWKMASTNVLSMAGNEVIAR
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttgtctttctcttcttgttgctattatcctctgcttctcatctctccagtgt
tccaacgccatcggcaaaggctaccgtctgatctccatggagaagtctcccgatgatggc
agcttcattggctatctccaagtgaagcagagtaacaaaatctacggctctgatataacc
atccttcgactcttcatcaactacagaacggatcatcgccttcgcgttcacattacagac
gcaaagaaacaacgatgggaagttccgtacaatctcctccgccgggaacaaccaccgaat
gtaatcggaaaatcaagaaaatctccggttacggtacaagaaatatccggaccggagctg
attttaatcttcaccgtagatcctttcagcttcgccgtaagaagaagatccaacggcgag
acgattttcaacactagtagctccgatgagtcattcggagagatggtgttcaaggaccag
tacctcgagatctcaacttctttacctaaagacgcgtctctatacggatttggtgaaaac
tctcaagccaatggaatcaaactggttcctaatgagccatacactctcttcactgaagac
gtctcggcgtttaatctcaacactgatctttacgggtcgcatccggtttacatggatttg
agaaacgttagtggtaaagcctatgcacactctgttctgcttcttaacagtcatggtatg
gatgtgttttacagaggcgattccttgacgtacaaggtaattggaggtgtttttgatttc
tatttcttcgctggaccgtcgcctcttaatgtcgttgatcaatacacttcgttaatagga
cggccagcgccaatgccgtactggtctctagggtttcaccaatgtagatgggggtaccgt
aatgtatcagttgttaaagatgtggtggataattaccaaaaggctaagatccctcttgat
gtgatttggaacgatgctgattacatggatggttacaaggacttcactttggatcttgtg
aattttcctcatgctaagctattgagtttcttggatagaatccataagatgggaatgaag
tatgttgtgataaaagatcctggtattggtgtcaacgcgagttacggtgtataccaaaga
ggcatggctagtgatgtgttcattaaatatgaaggaaagcctttcttggctcaagtgtgg
cctggtccagtttacttccctgatttccttaacccgaaaacggtttcttggtggggcgat
gaaattcgacgtttccatgagttagtacccattgatggtctttggatcgacatgaatgag
atcaatgctactggacacaaagcttctctagggttcaagactattcccacaagtgcttat
cactacaatggtgttcgtgagtacgacgctcacagcatctacgggttctctgaggccata
gcgacccacaaggccttgcttgctgtccaaggcaaacgtccatttatattgtcacggtcc
acttttgttggttcaggtcaatatgctgctcactggactggagataaccaaggaacatgg
cagagcttgcaagtatctatctcaacgatgttgaattttggaatttttggagttcctatg
gttggttcagatatatgtggattctttcctccaacaccagaagaactctgcaaccgttgg
attgaagttggtgcgttttaccccttttcaagagatcacgctgattactacgctccaaga
aaagagctttaccaatggggaacagtagcagagtcagctcgtaacgctcttgggatgaga
tacaaactccttccttttctctacactctcaactacgaagcccatatgagtggtgcacca
atcgctagaccgctcttcttctctttccctgagttcactgaatgctacggtttgagcaaa
cagttcttgctcggaagcagcttaatgatatcgccggttcttgaacaaggtaaaacccaa
gttgaagcactgttcccaccaggttcttggtaccacatgtttgacatgactcaggtcgtt
gtttcaaagaacgggaggcttttcaccctccccgctccgtttaacgttgtgaacgtgcat
ctttaccagaacgcgatactacccatgcaacaagtcgtcgctttcccggcgggagcatca
gagggatacgcctccgggaaactctttcttgatgatgatgagcttccggagatgaaactt
ggaaacgggaagtcaacgtacattgacttctacgcatcggttggaaatgagagtgtgaag
atatggtcgcaagtgaaagaaggtcagtttgcgttgagccaaggtttggtgattgagaaa
gtgattgttttgggacttaaaggaacatggaaagtttctgaaatacttcttaatggaagt
tcaatctccaatgagaccaagacgattgaggtaagctccaaggagcagatgtatgtggtg
ggttctgaagatgaaggagagagtaaaagcttcatggttgagcttaagggccttgagatg
ctagtgggtaaggacttcaacatatcttggaaaatggctagtactaatgtactatcaatg
gcaggaaatgaggttatcgcgcgctaa

DBGET integrated database retrieval system