KEGG   Arabidopsis thaliana (thale cress): AT3G48000Help
Entry
AT3G48000         CDS       T00041                                 

Gene name
ALDH2B4
Definition
(RefSeq) aldehyde dehydrogenase 2B4
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G48000 (ALDH2B4)
   00053 Ascorbate and aldarate metabolism
    AT3G48000 (ALDH2B4)
   00620 Pyruvate metabolism
    AT3G48000 (ALDH2B4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT3G48000 (ALDH2B4)
   00561 Glycerolipid metabolism
    AT3G48000 (ALDH2B4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT3G48000 (ALDH2B4)
   00310 Lysine degradation
    AT3G48000 (ALDH2B4)
   00330 Arginine and proline metabolism
    AT3G48000 (ALDH2B4)
   00340 Histidine metabolism
    AT3G48000 (ALDH2B4)
   00380 Tryptophan metabolism
    AT3G48000 (ALDH2B4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G48000 (ALDH2B4)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT3G48000 (ALDH2B4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT3G48000 (ALDH2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 823955
NCBI-ProteinID: NP_190383
MIPS: AT3G48000.1
TAIR: AT3G48000
Araport: AT3G48000
UniProt: Q9SU63
LinkDB All DBs
Position
3
AA seq 538 aa AA seqDB search
MAARRVSSLLSRSFSASSPLLFRSQGRNCYNGGILRRFGTSSAAAEEIINPSVQVSHTQL
LINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARTAFDEGPWPKMSAYE
RSRVLLRFADLVEKHSEELASLETWDNGKPYQQSLTAEIPMFARLFRYYAGWADKIHGLT
IPADGNYQVHTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTAFY
AGKLFLEAGLPPGVLNIVSGFGATAGAALASHMDVDKLAFTGSTDTGKVILGLAANSNLK
PVTLELGGKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSK
ARALKRVVGDPFRKGIEQGPQIDLKQFEKVMKYIKSGIESNATLECGGDQIGDKGYFIQP
TVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETKYGLAAGVFTKNLDTANRVS
RALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtagagtgtcttctcttttatctcgatctttttcagcttcctctccctta
ctgtttcgttctcaagggagaaattgttacaatggagggatcttaaggagatttggaacc
tcttctgctgctgctgaggaaatcataaacccatctgttcaagtttctcacacacagctc
ctcatcaatgggaactttgttgactctgcttctggtaagacgtttccgactcttgatccg
aggacaggcgaagtcattgctcatgtagctgaaggcgatgctgaagatatcaatcgagct
gtgaaagctgcaaggacggcctttgatgaaggaccttggcctaaaatgagtgcttatgaa
aggtcaagagttttgttgaggtttgcagatttggttgagaaacacagcgaagagctcgcg
tctctagagacatgggacaatggcaagccttaccaacaatccttgaccgcagagattccc
atgtttgcaagattgttccgttactatgctggatgggcggataagattcatggactaaca
attccagctgatggaaactatcaagttcacacattacatgaaccgataggtgtagctgga
cagatcataccgtggaattttccacttttgatgtttgcttggaaagttggtcctgctctt
gcttgtggtaacaccattgtcctcaaaaccgctgagcaaacacctctcacggctttctat
gctggaaagcttttccttgaagcgggtcttcctcctggtgttctgaatattgtttcggga
ttcggtgcaacagcaggtgctgccctcgcgagtcatatggatgtagacaagcttgctttt
acaggatcgactgatacggggaaagttatacttggattggctgctaacagcaatcttaag
cccgtaactctggaacttggagggaaatcaccgttcatcgtattcgaagatgctgatatt
gataaagctgtagagcttgcacactttgccctcttcttcaaccaggggcaatgttgctgc
gcggggtctcggacatttgttcatgagaaagtgtatgatgagtttgttgagaaatcaaag
gcacgcgcattgaaacgtgttgttggtgatcctttcaggaaaggcattgaacagggtcct
cagatcgatttgaagcaatttgagaaagtgatgaagtacataaagtcaggtatcgaaagc
aatgctactcttgaatgtggtggtgatcagattggagacaaaggttacttcatccaacct
actgtcttctctaatgttaaggatgacatgcttatcgctcaagacgagattttcggtcca
gtccaatcgatcttgaagttcagtgatgtggatgaggtgataaagagggcgaacgagacg
aagtacgggctagcggcaggggttttcacgaagaatctggacacggcaaacagggtttca
agggctttgaaagctggtaccgtatgggttaactgcttcgacgtatttgatgcagccata
ccatttggtggttacaagatgagtgggaatgggagagagaaaggcatatacagtctcaat
aattacttgcagatcaaggcagtcgtcactgctctaaataagcctgcctggatctga

DBGET integrated database retrieval system