KEGG   Arabidopsis thaliana (thale cress): AT3G48990Help
Entry
AT3G48990         CDS       T00041                                 

Gene name
AAE3
Definition
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K22133  oxalate---CoA ligase [EC:6.2.1.8]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G48990 (AAE3)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.8  oxalate---CoA ligase
     AT3G48990 (AAE3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C GH3
Motif
Other DBs
NCBI-GeneID: 824060
NCBI-ProteinID: NP_190468
MIPS: AT3G48990.1
TAIR: AT3G48990
Araport: AT3G48990
UniProt: Q9SMT7 A0A178V7A3
LinkDB All DBs
Structure
PDB: 

Position
3
AA seq 514 aa AA seqDB search
MDSDTLSGLLENVAKKFPDRRALSVSGKFNLTHARLHDLIERAASRLVSDAGIKPGDVVA
LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEA
ASKLKISHVTATLLDAGSDLVLSVADSDSVVDSATELVNHPDDGALFLHTSGTTSRPKGV
PLTQLNLASSVKNIKAVYKLTESDSTVIVLPLFHVHGLLAGLLSSLGAGAAVTLPAAGRF
SATTFWPDMKKYNATWYTAVPTIHQIILDRHASHPETEYPKLRFIRSCSASLAPVILSRL
EEAFGAPVLEAYAMTEATHLMSSNPLPEEGPHKPGSVGKPVGQEMAILNEKGEIQEPNNK
GEVCIRGPNVTKGYKNNPEANKAGFEFGWFHTGDIGYFDTDGYLHLVGRIKELINRGGEK
ISPIEVDAVLLTHPDVSQGVAFGVPDEKYGEEINCAVIPREGTTVTEEDIKAFCKKNLAA
FKVPKRVFITDNLPKTASGKIQRRIVAQHFLEKP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatactctctcaggattattggaaaacgtcgccaaaaaattccccgatcgc
cgagctctctccgtttctggaaaattcaatctcactcacgcgcgtcttcacgatctaatc
gaacgcgccgcttcacgccttgtctccgacgctggaatcaaacccggcgatgtcgttgct
ctcaccttccctaacaccgtcgagtttgttataatgtttttagcggtgataagagctaga
gccacggcggcgccgttgaacgcagcgtacacggcggaggaatttgagttttacctctcc
gattcagattcaaagctattgttaacctctaaagaaggaaacgcaccggctcaagaagca
gcttcaaagctgaaaatctctcacgtcaccgctacgctgcttgacgctggctcggacctt
gtactatccgttgcggattcagattccgtcgttgactcagcgacggaactcgttaatcac
ccggacgacggtgctctcttcctccacacttctggcactacgagccgtccaaagggtgta
ccgcttacgcagctcaatctagcttcatccgtcaagaacattaaagctgtgtacaagctt
actgagtctgattctacggtgattgttctccctctgttccatgttcatggattgttagct
gggttgcttagctcgcttggagctggtgctgctgtaactcttccagctgctggtagattc
tcagcaacaacattttggccagatatgaagaagtataacgctacatggtatactgctgtg
ccgaccattcatcagatcatattggaccgccacgcgagccaccctgagacggaatatcct
aaactccggttcatcaggagttgcagtgcttctttggctccggtgatattgtccaggctt
gaggaagcgtttggagcaccggtgctcgaggcctatgcaatgacagaggcaacacatttg
atgagctcaaaccccttaccagaggaaggtccacacaagcctgggtctgttgggaaaccg
gtaggtcaagaaatggcgatccttaatgagaaaggcgagatccaagagccaaataacaaa
ggagaggtttgtataagaggtccaaatgtgaccaagggttacaagaataacccagaagcc
aacaaggcaggtttcgagtttgggtggttccacactggtgatatcggttactttgatacc
gatgggtatttgcatctggtgggtcggatcaaagagcttattaaccgtggaggtgagaag
atatctccaattgaagtggatgcagtactcttaacgcatcctgacgtttctcagggtgtt
gcattcggtgttcctgatgagaaatatggggaagagattaactgtgcggtgattccaaga
gaaggaactactgtaaccgaagaggacattaaagcgttttgtaagaagaatttggcagct
ttcaaggtgccaaagagagtgttcatcactgataacctccccaaaactgcctctggtaag
attcagcgccgtatcgtcgcacaacatttccttgagaagccctga

DBGET integrated database retrieval system