KEGG   Arabidopsis thaliana (thale cress): AT3G50110Help
Entry
AT3G50110         CDS       T00041                                 

Gene name
PEN3
Definition
(RefSeq) PTEN 3
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00562  Inositol phosphate metabolism
ath01100  Metabolic pathways
ath04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT3G50110 (PEN3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AT3G50110 (PEN3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT3G50110 (PEN3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT3G50110 (PEN3)
    3.1.3.48  protein-tyrosine-phosphatase
     AT3G50110 (PEN3)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     AT3G50110 (PEN3)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    AT3G50110 (PEN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc CDKN3 Y_phosphatase3 Y_phosphatase PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 824173
NCBI-ProteinID: NP_566929
MIPS: AT3G50110.1
TAIR: AT3G50110
Araport: AT3G50110
UniProt: Q8H106 A0A178VJS2
LinkDB All DBs
Position
3
AA seq 632 aa AA seqDB search
METDPANSSSKSPAVVSEKDVLIPEPSENTVGVVQDPVSAEREAHEDSISTEASVAKVDD
TQMPASSTGSEPLSKTDDIVPCPPGSSPRESPPSIFSSSGLSSWAKSFKFQQQDPNRTDS
GMSAFTRFTSELGLHLPTKGSEEVGDSRSSNTQVGGAFESLTKAVVDSSRGAVKAMQVKA
RHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGLYRNHMEEVIKFF
ETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSAYTWLKEDIQ
NVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKALVLPSQIRYVKY
YERVQNQFDGKVPPERRCMLRGFRLINCPYWIRPAITISNHTDILFSTKKHQKTKDLGPE
DFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSDGDFYCWLNTTLTDNRTMLKGSDF
DGFDKRKLPAPGFHVEIVMIEPDNSQPTKSKSDSTQQQSQSSSSADSSKLKSNEKDDDVF
SDSDGEEEGNSQSYSTNEKTASSMHTTSKPHQINEPPKRDDPSANRSVTSSSSSGHYNPI
PNNSLAVSDIKAIAADASVFSFGDEEEDYESD
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgatcctgctaactcttcatcgaagtctccagctgtagtatctgagaaagat
gtattgattcctgaaccttctgaaaatactgtgggcgttgtacaagatcctgtgagcgct
gaaagagaagctcatgaagactctattagtacagaagcttctgttgcaaaggttgatgat
actcaaatgcctgctagttctaccggctctgaacctttaagtaaaacagatgatatagtt
ccatgcccaccaggttcctccccacgcgaatcaccgccgtctatattttcttcttctggt
ctttcttcttgggccaaaagttttaaattccagcagcaagatccaaatcgtacagattct
gggatgtcagctttcacaagattcacctctgaacttggtctgcatttgccaacgaaaggg
tctgaggaggttggtgattctagatcatcaaacacacaagttggtggtgcttttgagtcc
ctcacaaaagctgtggttgattcatctcgtggtgccgttaaagcaatgcaggtgaaagca
cgccacattgtctctcagaacaaaagaagataccaggagggggaattcgatttggacatg
acatatataactgagaatataatcgcaatggggttcccagctggtgacataagctctggt
cttttcggatttttcgagggactatatcgtaatcacatggaagaggtgataaagtttttt
gaaactcatcataaggataaatataaggtctacaacctttgttcagagagattgtacgat
gcttcaagatttgaggggaaggttgcatctttcccatttgatgatcataattgtcctcct
atccaattgataccatcgttttgtcaaagtgcatacacatggctgaaggaagatatccaa
aatgtagtggtagttcattgtaaagctggaatggcaagaaccggattaatgatttgctgt
cttcttctatatctcaagttctttcctacagctgaagaggctattgattactataaccaa
aagagatgtcttgatgggaaagctcttgttctcccaagtcagattcgatatgtcaagtac
tacgaacgtgttcaaaaccaatttgacgggaaagttccacccgagcgaagatgcatgctc
agaggatttcgcctaatcaactgcccttactggattagacctgccattacgatctccaac
cacactgatatacttttctcaacaaagaaacatcagaaaaccaaggatttggggcctgaa
gatttttggataaaggcacccaaaaagggagtggttgtctttgcaatacctggtgaagct
ggtctaacagaattagccggcgacttcaaaatccactttcaagatagcgatggagatttc
tactgttggctaaatactacactgactgataacagaacaatgctgaaaggcagtgacttt
gatggctttgacaagagaaaactgcctgcaccgggtttccatgtcgagatcgtaatgata
gaacccgacaattcacaaccaacaaagtccaaatctgattccacccaacaacaatctcaa
agcagctccagtgctgattccagcaaacttaagtctaatgagaaagacgacgatgtattc
tctgacagtgatggggaagaggaaggaaactctcagtcttattcaactaacgagaaaacc
gcaagctcaatgcacacaactagtaaacctcatcagatcaatgagccaccaaagagagat
gacccttccgcaaacagaagtgtcacaagttcatcgtcctcgggtcattataatccaata
ccaaacaactcattagcagttagtgatatcaaagctattgctgcagatgcatcggtcttc
tcctttggagatgaggaagaagactatgaaagcgactga

DBGET integrated database retrieval system