KEGG   Arabidopsis thaliana (thale cress): AT3G54900
Entry
AT3G54900         CDS       T00041                                 

Symbol
CXIP1
Name
(RefSeq) CAX interacting protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Glutaredoxin GST_N_3 SH3BGR
Other DBs
NCBI-GeneID: 824655
NCBI-ProteinID: NP_191050
TAIR: AT3G54900
UniProt: Q84Y95 A0A654FH53
Structure
LinkDB
Position
3:complement(20341357..20342464)
AA seq 173 aa
MALRSVKTPTLITSVAVVSSSVTNKPHSIRFSLKPTSALVVHNHQLSFYGSNLKLKPTKF
RCSASALTPQLKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNIL
ENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVEKAMCS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggctctccgatctgtcaaaacgccgaccttgataacttcggtcgccgtcgtctcctcc
tccgttaccaacaagcctcactctatcagattctctcttaaaccaacgtcggcactcgtc
gtccataaccatcagctatcgttctacggttcgaatctcaagctgaaaccaactaaattc
cgatgctcagcgtcggctcttacgccgcaacttaaagacacgctggagaaactggtgaat
tcggagaaagtggttctgtttatgaaaggaacgagagacttcccgatgtgtggattctcc
aacactgtggttcagattttgaagaatctgaatgttcctttcgaagatgtgaatattctg
gagaatgagatgttgaggcaaggacttaaagagtattcgaattggccgacgtttcctcag
ctttatatcggcggtgagtttttcggtggttgtgatattactcttgaggcgtttaagact
ggagaattgcaggaagaggtggagaaagctatgtgctcttga

DBGET integrated database retrieval system