KEGG   Arabidopsis thaliana (thale cress): AT3G56490
Entry
AT3G56490         CDS       T00041                                 

Symbol
HIT3
Name
(RefSeq) HIS triad family protein 3
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 824816
NCBI-ProteinID: NP_567038
TAIR: AT3G56490
UniProt: Q8GUN2 A0A178VI77
LinkDB
Position
3:20941285..20943469
AA seq 147 aa
MSHRVSILSSHFSPASAVMASEKEAALAATPSDSPTIFDKIISKEIPSTVVFEDDKVLAF
RDITPQGPVHILLIPKVRDGLTGLSKAEERHIDILGRLLYTAKLVAKQEGLAEGFRIVIN
DGPQGCQSVYHIHVHLIGGRQMNWPPG
NT seq 444 nt   +upstreamnt  +downstreamnt
atgagccaccgtgtttcgattctatcatctcatttctcacctgcctccgccgtcatggct
tccgagaaagaagctgctctcgccgccactccttccgattctcccaccatatttgacaag
atcatcagcaaagagattccatccaccgtggtttttgaggatgacaaggtcttagctttt
agggacataacgccccagggtcctgttcacatcctccttattccaaaagtgagggatggc
ctaactggcctctctaaggctgaggaaaggcacatcgacatcttgggccgccttctctac
actgccaagcttgtagcaaaacaagaaggcctagcagagggtttcagaattgttatcaat
gatggtcctcaaggctgtcaatcggtgtatcacattcatgttcatctcattggaggacgc
caaatgaactggcctcctggttaa

DBGET integrated database retrieval system