KEGG   Arabidopsis thaliana (thale cress): AT4G01610Help
Entry
AT4G01610         CDS       T00041                                 

Definition
(RefSeq) Cysteine proteinases superfamily protein
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT4G01610
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT4G01610
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT4G01610
   00536 Glycosaminoglycan binding proteins [BR:ath00536]
    AT4G01610
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     AT4G01610
Peptidases and inhibitors [BR:ath01002]
 Cysteine peptidases
  Family C1: papain family
   AT4G01610
Chaperones and folding catalysts [BR:ath03110]
 Intramolecular chaperones
  Papain family
   AT4G01610
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   AT4G01610
Glycosaminoglycan binding proteins [BR:ath00536]
 Heparan sulfate / Haparin
  Others
   AT4G01610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Propeptide_C1
Motif
Other DBs
NCBI-GeneID: 826792
NCBI-ProteinID: NP_567215
MIPS: AT4G01610.1
TAIR: AT4G01610
Araport: AT4G01610
UniProt: Q94K85 A0A178UYV4
LinkDB All DBs
Position
4
AA seq 359 aa AA seqDB search
MAVYNTKLCLASVFLLLGLLLAFDLKGIEAESLTKQKLDSKILQDEIVKKVNENPNAGWK
AAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSLKLPKAFDARTAWPQCTSIG
NILDQGHCGSCWAFGAVESLSDRFCIQFGMNISLSVNDLLACCGFRCGDGCDGGYPIAAW
QYFSYSGVVTEECDPYFDNTGCSHPGCEPAYPTPKCSRKCVSDNKLWSESKHYSVSTYTV
KSNPQDIMAEVYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTSSEGE
DYWLMANQWNRGWGDDGYFMIRRGTNECGIEDEPVAGLPSSKNVFRVDTGSNDLPVASV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacaataccaaactctgtttggcctctgttttcttgctcttagggcttctc
ttggcttttgacttgaagggtatagaagcagaaagtcttaccaaacagaaactggactcg
aagatacttcaggatgagattgtgaagaaagtcaacgaaaacccaaacgctggatggaaa
gctgctataaatgatcgattttcaaacgccactgttgcagagtttaagcgtcttctcggt
gttaaaccaacaccaaagaagcatttcttaggtgttcctattgtgagccatgatccatct
ttgaagctacctaaagcttttgatgctagaactgcttggccacagtgcactagtattgga
aacatcttagatcagggacattgtggttcttgctgggcatttggtgctgttgaatcacta
tcagatagattctgtatccaatttggcatgaacatttctttatcagtaaatgatctccta
gcttgttgtggattccgttgtggtgatggttgtgacggtggctatccaattgctgcttgg
caatacttttcgtatagcggtgttgtcacagaagagtgtgatccatactttgataatacc
ggatgctctcacccgggttgcgaaccggcatatcctacaccgaaatgttcgaggaaatgc
gttagcgacaacaaactatggagcgagtcgaagcattacagtgttagtacatacactgtg
aaatctaatccacaagatatcatggcagaggtttataagaatggacctgttgaagtctct
tttaccgtttatgaggattttgctcattacaaatctggagtctataagcacataacaggt
tctaacattggaggtcatgctgttaaacttattggttggggaactagcagtgaaggagaa
gattattggttgatggcaaatcaatggaacagaggctggggtgatgatggttatttcatg
ataaggagaggaactaatgaatgtggaattgaagatgaaccagtagctggtttgccttca
agcaagaatgtgtttagggttgataccggttcgaatgatcttccggttgcatcggtttaa

DBGET integrated database retrieval system