KEGG   Arabidopsis thaliana (thale cress): AT4G13460Help
Entry
AT4G13460         CDS       T00041                                 

Gene name
SUVH9
Definition
(RefSeq) SU(VAR)3-9 homolog 9
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AT4G13460 (SUVH9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT4G13460 (SUVH9)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AT4G13460 (SUVH9)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AT4G13460 (SUVH9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 826978
NCBI-ProteinID: NP_001031625
MIPS: AT4G13460.1
TAIR: AT4G13460
Araport: AT4G13460
UniProt: Q9T0G7 B9DGV6
LinkDB All DBs
Structure
PDB: 

Position
4
AA seq 650 aa AA seqDB search
MGSSHIPLDPSLNPSPSLIPKLEPVTESTQNLAFQLPNTNPQALISSAVSDFNEATDFSS
DYNTVAESARSAFAQRLQRHDDVAVLDSLTGAIVPVEENPEPEPNPYSTSDSSPSVATQR
PRPQPRSSELVRITDVGPESERQFREHVRKTRMIYDSLRMFLMMEEAKRNGVGGRRARAD
GKAGKAGSMMRDCMLWMNRDKRIVGSIPGVQVGDIFFFRFELCVMGLHGHPQSGIDFLTG
SLSSNGEPIATSVIVSGGYEDDDDQGDVIMYTGQGGQDRLGRQAEHQRLEGGNLAMERSM
YYGIEVRVIRGLKYENEVSSRVYVYDGLFRIVDSWFDVGKSGFGVFKYRLERIEGQAEMG
SSVLKFARTLKTNPLSVRPRGYINFDISNGKENVPVYLFNDIDSDQEPLYYEYLAQTSFP
PGLFVQQSGNASGCDCVNGCGSGCLCEAKNSGEIAYDYNGTLIRQKPLIHECGSACQCPP
SCRNRVTQKGLRNRLEVFRSLETGWGVRSLDVLHAGAFICEYAGVALTREQANILTMNGD
TLVYPARFSSARWEDWGDLSQVLADFERPSYPDIPPVDFAMDVSKMRNVACYISHSTDPN
VIVQFVLHDHNSLMFPRVMLFAAENIPPMTELSLDYGVVDDWNAKLAICN
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgggttcttctcacattcctcttgatccgtctctaaatccgtcaccttcactgatccca
aagcttgaaccagtcactgaatcaacccaaaacttggcctttcaacttccaaacacaaac
ccacaagccctaatttcatcagccgtctccgatttcaacgaagccacagacttttcctca
gattacaacaccgtcgccgagtcagcccggtctgctttcgctcaacggcttcaacgtcac
gatgatgttgcggttcttgattccttaaccggagcaatcgtaccggttgaggagaatccg
gaaccggaaccgaatccttactcaaccagtgactcttcaccgtcggttgctactcaacga
cctagaccgcagccacgttcgtcggagctagtgaggatcactgatgttggacctgaaagt
gagagacagtttcgtgaacatgtgaggaagacgagaatgatttatgattctcttaggatg
tttttgatgatggaagaagctaaacgtaatggggttggtggaagaagagctagagctgat
ggtaaagctggtaaagctggttcaatgatgagagattgtatgttgtggatgaatcgtgat
aaacgaatcgtcggttcgattcccggtgttcaagttggggatatcttcttctttaggttt
gagttatgtgtcatgggcttacatggacaccctcaatctgggatcgattttcttacaggg
agtcttagttctaatggggagccaatagctactagtgtgattgtttctggtgggtatgag
gatgatgatgatcaaggagatgtgattatgtatacaggtcagggtggacaagataggctt
ggaaggcaagctgaacatcagaggctggaaggtggaaaccttgcgatggaacggagtatg
tattatgggattgaagtgagagttattagagggttgaagtatgagaatgaggtttctagt
agagtttatgtttatgatgggttgtttaggattgttgattcttggtttgatgttgggaag
tctggtttcggtgtgtttaaatatcggttggagaggattgaaggacaggctgagatgggt
agttcggtgttgaagtttgctaggactcttaagactaatccattgtctgtgagaccgaga
ggttacatcaatttcgatatctcgaatgggaaggagaatgttcctgtctatttgtttaac
gacattgacagcgatcaagaacctttgtattatgagtatcttgcgcaaacttcgtttcct
cctggcttatttgttcagcaaagtggtaatgcaagtggatgtgactgtgtcaatggttgt
ggcagtggctgcctttgtgaagccaagaattcaggtgagattgcttatgattataatggg
acgctaataagacagaaaccgttgatacatgaatgtggatcagcgtgtcagtgccctcca
agctgtcgaaaccgtgtgactcaaaagggtttgaggaataggctagaagtgtttaggtca
ctggaaacgggttggggagttcggtctttggatgtattacatgctggtgcttttatttgt
gagtatgctggggttgctttgacaagggaacaagccaacattctgaccatgaacggtgat
acattggtatatcctgctcgtttctcttctgcgagatgggaagattggggagatctgtct
caggtccttgctgatttcgagcggccttcttatcctgatattcctccggttgatttcgca
atggatgtgtccaagatgaggaatgttgcttgttacataagccacagtactgatccgaat
gtcattgtccagtttgtactccatgatcacaacagtctcatgttccctagagtcatgctt
ttcgctgctgaaaacatccctcccatgactgagctcagccttgattacggagtagttgat
gattggaacgccaagcttgccatttgtaattaa

DBGET integrated database retrieval system