KEGG   Arabidopsis thaliana (thale cress): AT4G17510Help
Entry
AT4G17510         CDS       T00041                                 

Gene name
UCH3
Definition
(RefSeq) ubiquitin C-terminal hydrolase 3
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT4G17510 (UCH3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT4G17510 (UCH3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT4G17510 (UCH3)
Peptidases and inhibitors [BR:ath01002]
 Cysteine peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AT4G17510 (UCH3)
Ubiquitin system [BR:ath04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    AT4G17510 (UCH3)
  UBL-specific proteases (ULPs)
   AT4G17510 (UCH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 827466
NCBI-ProteinID: NP_193484
MIPS: AT4G17510.1
TAIR: AT4G17510
Araport: AT4G17510
UniProt: Q8GWE1 A0A178V2F1
LinkDB All DBs
Position
4
AA seq 234 aa AA seqDB search
MATASESSSSKRWLPLESNPDVMNQYLWGLGLAPDEAECNDVYGLDDELLEMVPKPVLAV
LFLYPITKKSEEERIEQDKEIKEKVHSDKVYFMKQTVGNACGTIGLLHAIGNITSEIKLS
DGSFLDRFFKSTANMTPMERAKFLENDSQIEDAHSVAVIAGDTPASEDADTHFICLACVE
GELYELDGRKAGPISHGASSPATLLKDATKVIKKMIEKNPGSLNFNLIAISKRT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcaagcgagagttcttcatctaagagatggcttccacttgaatctaaccca
gatgttatgaatcagtatctctggggacttggtcttgcccctgatgaagcagagtgcaat
gatgtgtatgggttagacgatgaacttctagagatggttccaaagcctgttcttgctgtt
ctcttcctttacccaatcaccaaaaagagtgaagaagagagaatcgagcaagacaaggaa
attaaggaaaaggtgcatagcgataaagtttactttatgaaacaaactgttggtaatgct
tgtggaaccattggtcttcttcatgctattgggaatattacctctgaaatcaaactctcc
gacggatcgttcttggatagattcttcaaatccactgccaacatgactcctatggagcgt
gccaagtttctcgagaatgacagtcaaatagaagatgctcattctgtagctgttatagct
ggtgatacacctgcttcagaagacgcagacacgcatttcatttgtttagcttgtgtagaa
ggtgagctctatgaacttgatggaagaaaggcaggaccgatttcacacggtgcttcctct
ccagctaccctcctgaaggacgcaacaaaagtgataaagaagatgatcgagaagaatccg
ggctctctcaacttcaacctgatagccatctctaagagaacctga

DBGET integrated database retrieval system