KEGG   Arabidopsis thaliana (thale cress): AT4G20890Help
Entry
AT4G20890         CDS       T00041                                 

Gene name
TUB9
Definition
(RefSeq) tubulin beta-9 chain
  KO
K07375  tubulin beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT4G20890 (TUB9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT4G20890 (TUB9)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT4G20890 (TUB9)
   04147 Exosome [BR:ath04147]
    AT4G20890 (TUB9)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AT4G20890 (TUB9)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AT4G20890 (TUB9)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT4G20890 (TUB9)
  Exosomal proteins of colorectal cancer cells
   AT4G20890 (TUB9)
  Exosomal proteins of bladder cancer cells
   AT4G20890 (TUB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 827837
NCBI-ProteinID: NP_193821
MIPS: AT4G20890.1
TAIR: AT4G20890
Araport: AT4G20890
UniProt: P29517 A0A178UU99
LinkDB All DBs
Position
4
AA seq 444 aa AA seqDB search
MREILHIQGGQCGNQIGAKFWEVICGEHGIDQTGQSCGDTDLQLERINVYFNEASGGKYV
PRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLANPTFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYSALSVPELTQQMWDAKNMM
CAADPRHGRYLTASAVFRGKMSTKEVDEQMMNVQNKNSSYFVEWIPNNVKSSVCDIAPTG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVA
EYQQYQDATVGEEEYEEDEEEEEA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattcttcatattcaaggaggtcagtgcggaaaccagatcggagctaagttc
tgggaagttatttgcggcgagcacggtattgatcaaaccggtcagtcatgtggcgataca
gatctacagcttgaaaggatcaatgtctattttaacgaagctagcggaggcaaatacgtt
cctcgtgctgttcttatggatctggagcctggaactatggattctctcagatctgggccg
tttggtcagattttccggcctgataacttcgtttttggtcagtctggtgctgggaataac
tgggcgaaaggtcattacacggagggagctgagttgattgattctgtgcttgatgttgtg
aggaaggaagctgagaactgtgattgtcttcaaggttttcaagtttgtcattctttggga
ggaggaactggttctggaatgggaacacttcttatttctaagattagagaggaatatcca
gatcgtatgatgatgaccttttcggtcttcccatctcctaaggtctctgatacagttgtt
gagccatacaatgctactctttccgttcaccagctcgttgagaatgctgatgaatgtatg
gttttggataacgaagctctttacgatatctgtttccgtaccttgaagcttgctaatcct
acatttggtgaccttaaccatctcatctcagctacaatgagtggtgttacatgctgtctt
cggttccctggtcaactaaactctgaccttagaaaacttgctgtgaaccttattcctttc
ccacgactccacttcttcatggttggttttgcacctttgacatcaagaggatctcaacaa
tacagtgccttgagtgtccctgagctaactcaacagatgtgggatgccaaaaacatgatg
tgtgcagctgatcctcgtcatggtcgttacttgacagcttctgctgtcttccgtggaaag
atgagtaccaaagaggttgatgaacagatgatgaacgtccagaacaaaaactcctcatac
tttgttgaatggattccaaataacgtgaaatcaagcgtctgcgatatagctcccactggt
ttgaaaatggcatcaactttcattggaaactcaacttcaatccaggaaatgttcaggcgt
gtgagtgaacagttcactgccatgttcaggagaaaggctttccttcattggtacacagga
gaaggaatggacgagatggagttcactgaagcagagagtaacatgaatgatcttgttgca
gagtatcagcaatatcaagatgctacagtcggtgaagaggagtacgaggaggacgaagaa
gaagaagaagcctaa

DBGET integrated database retrieval system