KEGG   Arabidopsis thaliana (thale cress): AT4G29130Help
Entry
AT4G29130         CDS       T00041                                 

Gene name
HXK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00051  Fructose and mannose metabolism
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath00520  Amino sugar and nucleotide sugar metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ath_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT4G29130 (HXK1)
   00051 Fructose and mannose metabolism
    AT4G29130 (HXK1)
   00052 Galactose metabolism
    AT4G29130 (HXK1)
   00500 Starch and sucrose metabolism
    AT4G29130 (HXK1)
   00520 Amino sugar and nucleotide sugar metabolism
    AT4G29130 (HXK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AT4G29130 (HXK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G29130 (HXK1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AT4G29130 (HXK1)
Membrane trafficking [BR:ath04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AT4G29130 (HXK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 829034
NCBI-ProteinID: NP_194642
MIPS: AT4G29130.1
TAIR: AT4G29130
Araport: AT4G29130
UniProt: Q42525 A0A384KTL6 Q0WLE0
LinkDB All DBs
Structure
PDB: 

Position
4
AA seq 496 aa AA seqDB search
MGKVAVGATVVCTAAVCAVAVLVVRRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVAD
AMTVEMHAGLASDGGSKLKMLISYVDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQER
VVKQEFEEVSIPPHLMTGGSDELFNFIAEALAKFVATECEDFHLPEGRQRELGFTFSFPV
KQTSLSSGSLIKWTKGFSIEEAVGQDVVGALNKALERVGLDMRIAALVNDTVGTLAGGRY
YNPDVVAAVILGTGTNAAYVERATAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEFDH
TLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHM
SAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRKVVISLCNIIATRGARLSAAGIYGILKK
LGRDTTKDEEVQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGI
GAALLAASHSLYLEDS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtagctgttggagcgactgttgtttgcacggcggcggtttgtgcggtggct
gttttggttgttcgacgacggatgcagagctcagggaagtggggacgtgttttggctatc
ctcaaggcctttgaagaggattgtgcgactccgatctcgaaactgagacaagtggctgat
gctatgaccgttgagatgcatgctggtcttgcatccgacggtggtagcaaactcaagatg
cttatcagctacgttgataatcttccttccggggatgaaaagggtctcttttatgcattg
gacctaggggggacaaacttccgtgtcatgcgtgtgcttcttggcgggaagcaagagcgt
gttgttaaacaagaattcgaagaagtttcgattcctcctcatttgatgactggtggttca
gatgagttgttcaattttatagctgaagctcttgcgaagtttgtcgctacagaatgcgaa
gactttcatcttccagaaggtagacagagggaattaggtttcactttctcgtttcctgtt
aagcagacttctctgtcctctggtagtctcatcaaatggacaaaaggcttttccatcgaa
gaagcagttggacaagatgttgttggagcacttaataaggctctggaaagagttggtctt
gacatgcgaatcgcagcacttgttaatgataccgttggaacactagccggtggtagatac
tataacccggatgttgttgctgctgttattttaggcactgggacaaacgcagcctatgtt
gagcgtgcaaccgcgatccctaaatggcatggtctgcttccaaaatcaggagaaatggtt
ataaacatggaatggggaaacttcaggtcatcacatcttccattaaccgagtttgatcac
acgctggatttcgagagtctgaatccaggcgaacagattcttgagaaaatcatttccggt
atgtacttgggagagattttgcgaagagttcttctaaagatggctgaagatgctgctttc
tttggcgatacagtcccatctaagctgagaataccattcatcattaggactcctcacatg
tcggctatgcacaacgacacttctccagacttgaagattgttgggagcaagattaaggat
atattggaggtccctacaacttctctgaaaatgagaaaagttgtgatcagtctctgcaac
atcatagcaacccgaggagctcgtctctctgctgctggaatctatggtattctgaagaaa
ctgggaagagatactactaaagacgaggaggtgcagaaatcggttatagccatggatggt
ggattgtttgagcattacactcagtttagtgagtgtatggagagctcactaaaagagttg
cttggagatgaagcttcaggaagcgttgaagtcactcactccaatgatggatcaggcatt
ggagctgcgcttcttgctgcttctcactctctctaccttgaagactcttaa

DBGET integrated database retrieval system