KEGG   Arabidopsis thaliana (thale cress): AT4G36220
Entry
AT4G36220         CDS       T00041                                 

Gene name
FAH1
Definition
(RefSeq) ferulic acid 5-hydroxylase 1
  KO
K09755  ferulate-5-hydroxylase [EC:1.14.-.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT4G36220 (FAH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ath00199]
    AT4G36220 (FAH1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     AT4G36220 (FAH1)
Cytochrome P450 [BR:ath00199]
 Cytochrome P450, plant type
  CYP84 family
   AT4G36220 (FAH1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 829779
NCBI-ProteinID: NP_195345
MIPS: AT4G36220.1
TAIR: AT4G36220
UniProt: Q42600 A0A178UUR1
LinkDB
Position
4
AA seq 520 aa
MESSISQTLSKLSDPTTSLVIVVSLFIFISFITRRRRPPYPPGPRGWPIIGNMLMMDQLT
HRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDR
ADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGKPINVGEQI
FALTRNITYRAAFGSACEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWIDPQGINKRLV
KARNDLDGFIDDIIDEHMKKKENQNAVDDGDVVDTDMVDDLLAFYSEEAKLVSETADLQN
SIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVE
ESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKKSRVMINAFAIGRDPT
SWTDPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHILHCFT
WKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICAL
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggagtcttctatatcacaaacactaagcaaactatcagatcccacgacgtctcttgtc
atcgttgtctctcttttcatcttcatcagcttcatcacacggcggcgaaggcctccatat
cctcccggtccacgaggttggcccatcataggcaacatgttaatgatggaccaactcacc
caccgtggtttagccaatttagctaaaaagtatggcggattgtgccatctccgcatggga
ttcctccatatgtacgctgtctcatcacccgaggtggctcgacaagtccttcaagtccaa
gacagcgtcttctcgaaccggcctgcaactatagctataagctatctgacttacgaccga
gcggacatggctttcgctcactacggaccgttttggagacagatgagaaaagtgtgtgtc
atgaaggtgtttagccgtaaaagagctgagtcatgggcttcagttcgtgatgaagtggac
aaaatggtccggtcggtctcttgtaacgttggtaagcctataaacgtcggggagcaaatt
tttgcactgacccgcaacataacttaccgggcagcgtttgggtcagcctgcgagaaggga
caagacgagttcataagaatcttacaagagttctctaagctttttggagccttcaacgta
gcggatttcataccatatttcgggtggatcgatccgcaagggataaacaagcggctcgtg
aaggcccgtaatgatctagacggatttattgacgatattatcgatgaacatatgaagaag
aaggagaatcaaaacgctgtggatgatggggatgttgtcgataccgatatggttgatgat
cttcttgctttttacagtgaagaggccaaattagtcagtgagacagcggatcttcaaaat
tccatcaaacttacccgtgacaatatcaaagcaatcatcatggacgttatgtttggagga
acggaaacggtagcgtcggcgatagagtgggccttaacggagttattacggagccccgag
gatctaaaacgggtccaacaagaactcgccgaagtcgttggacttgacagacgagttgaa
gaatccgacatcgagaagttgacttatctcaaatgcacactcaaagaaaccctaaggatg
cacccaccgatccctctcctcctccacgaaaccgcggaggacactagtatcgacggtttc
ttcattcccaagaaatctcgtgtgatgatcaacgcgtttgccataggacgcgacccaacc
tcttggactgacccggacacgtttagaccatcgaggtttttggaaccgggcgtaccggat
ttcaaagggagcaatttcgagtttataccgttcgggtcgggtcgtagatcgtgcccgggt
atgcaactagggttatacgcgcttgacttagccgtggctcatatattacattgcttcacg
tggaaattacctgatgggatgaaaccaagtgagctcgacatgaatgatgtgtttggtctc
acggctcctaaagccacgcggcttttcgccgtgccaaccacgcgcctcatctgtgctctt
taa

DBGET integrated database retrieval system