KEGG   Arabidopsis thaliana (thale cress): AT4G39910Help
Entry
AT4G39910         CDS       T00041                                 

Gene name
UBP3
Definition
(RefSeq) ubiquitin-specific protease 3
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT4G39910 (UBP3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT4G39910 (UBP3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT4G39910 (UBP3)
Peptidases and inhibitors [BR:ath01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   AT4G39910 (UBP3)
Ubiquitin system [BR:ath04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AT4G39910 (UBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUF4276
Motif
Other DBs
NCBI-GeneID: 830150
NCBI-ProteinID: NP_568074
MIPS: AT4G39910.1
TAIR: AT4G39910
Araport: AT4G39910
UniProt: O24454
LinkDB All DBs
Position
4
AA seq 371 aa AA seqDB search
MGAAGSKLEKALGDQFPEGERYFGFENFGNTCYCNSVLQALYFCVPFREQLLEYYTSNKS
VADAEENLMTCLADLFSQISSQKKKTGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNYL
LNEVVDILEKEAKATKTEHETSSSSSPEKIANGLKVPQANGVVHKEPIVTWVHNIFQGIL
TNETRCLRCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLHAEDKFFCDKCCSLQ
EAQKRMKIKKPPHILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTVEPYADVEYSL
FAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDHGY
ILFYESLGPTK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgcgggctccaaactcgagaaagctctcggcgaccagttccccgaaggtgaa
cgctactttggattcgagaatttcggcaacacttgctactgtaacagcgttttgcaggct
ctttatttctgtgttcctttccgtgaacaactgctcgaatactataccagtaataaaagc
gtggccgatgctgaagagaatcttatgacctgcctggcagacttgttttcgcagataagt
tcccagaagaagaaaacaggtgttattgcgcctaagcgatttgtacagaggttgaagaaa
caaaatgagctgtttcggagttatatgcaccaggatgcacatgaattcctgaattatttg
ctgaatgaagttgttgacatactggagaaagaggcaaaagctacaaaaactgaacatgaa
acctcgtcatcatcatctcccgagaagatagcaaatggactgaaagttcctcaggcaaat
ggtgttgtgcacaaggagcctattgttacatgggtgcacaatatttttcagggcatactt
accaacgagacaaggtgtctgcgatgtgaaacagtgacagcaagagacgaaacattccta
gacctaagccttgatatcgaacagaacagttcgataactagctgtttgaaaaacttcagc
tccacagagacgcttcacgctgaagacaaattcttttgtgacaaatgctgcagcttacaa
gaagcacaaaagcggatgaagatcaagaagccaccacacatcctagtgattcatctaaaa
cgattcaaatacatcgaacagctaggccgctacaagaagctctcctatagagttgtcttc
cctttggagctaaaactgagcaacacagtggaaccatacgcagacgtggagtactctctg
tttgcagtggtggttcatgtgggaagtggacccaaccatggtcattacgtaagccttgtg
aaaagccataaccattggctcttctttgatgatgagaatgttgagatgattgaagaatca
gctgttcaaacattctttggatcgtctcaggagtattcgagcaatactgaccatggttac
atcctgttctatgagagccttggaccgaccaagtga

DBGET integrated database retrieval system