KEGG   Arabidopsis thaliana (thale cress): AT5G11720Help
Entry
AT5G11720         CDS       T00041                                 

Definition
(RefSeq) Glycosyl hydrolases family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AT5G11720
   00500 Starch and sucrose metabolism
    AT5G11720
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AT5G11720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 831044
NCBI-ProteinID: NP_196733
MIPS: AT5G11720.1
TAIR: AT5G11720
Araport: AT5G11720
UniProt: Q9LYF8
LinkDB All DBs
Position
5
AA seq 902 aa AA seqDB search
MSSLHWFPNIFIVVVVFFSLRSSQVVLEEEESTVVGYGYVVRSVGVDSNRQVLTAKLDLI
KPSSVYAPDIKSLNLHVSLETSERLRIRITDSSQQRWEIPETVIPRAGNHSPRRFSTEED
GGNSPENNFLADPSSDLVFTLHNTTPFGFSVSRRSSGDILFDTSPDSSDSNTYFIFKDQF
LQLSSALPENRSNLYGIGEHTKRSFRLIPGETMTLWNADIGSENPDVNLYGSHPFYMDVR
GSKGNEEAGTTHGVLLLNSNGMDVKYEGHRITYNVIGGVIDLYVFAGPSPEMVMNQYTEL
IGRPAPMPYWSFGFHQCRYGYKNVSDLEYVVDGYAKAGIPLEVMWTDIDYMDGYKDFTLD
PVNFPEDKMQSFVDTLHKNGQKYVLILDPGIGVDSSYGTYNRGMEADVFIKRNGEPYLGE
VWPGKVYFPDFLNPAAATFWSNEIKMFQEILPLDGLWIDMNELSNFITSPLSSGSSLDDP
PYKINNSGDKRPINNKTVPATSIHFGNISEYDAHNLYGLLEAKATHQAVVDITGKRPFIL
SRSTFVSSGKYTAHWTGDNAAKWEDLAYSIPGILNFGLFGIPMVGADICGFSHDTTEELC
RRWIQLGAFYPFARDHSSLGTARQELYLWDSVASSARKVLGLRMRLLPHLYTLMYEAHVS
GNPIARPLFFSFPQDTKTYEIDSQFLIGKSIMVSPALKQGAVAVDAYFPAGNWFDLFNYS
FAVGGDSGKHVRLDTPADHVNVHVREGSIVAMQGEALTTRDARKTPYQLLVVASRLENIS
GELFLDDGENLRMGAGGGNRDWTLVKFRCYVTGKSVVLRSEVVNPEYASKMKWSIGKVTF
VGFENVENVKTYEVRTSERLRSPRISLIKTVSDNDDPRFLSVEVSKLSLLVGKKFEMRLR
LT
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcttcactggtttcccaatatcttcatcgttgtcgtcgtcttcttctccttg
agaagttcacaagttgtactagaagaagaagaatccacagtcgttggatacggctacgtc
gttagatcagtgggcgttgattctaaccggcaagttttgacggcgaagcttgatctgata
aaaccatcgtccgtttacgcaccagatattaaatcgcttaatcttcatgtcagcttggag
acaagtgagcgtttgagaatcagaatcacagactctagtcaacaaagatgggagataccg
gaaaccgttattcctcgtgccggaaaccactctcctcgccgtttctcaacggaggaagac
ggaggaaactctccggagaacaatttcttagcagatccctcatcggacttggttttcact
ctccacaacacgacgccgtttggtttctccgtctcccgacgttcctccggcgatatcctc
ttcgacacatcgccggattcatcagattcaaacacttacttcatcttcaaagaccaattc
cttcaactatcatccgcgttaccggaaaacagatcgaatctgtacggaatcggagagcac
acgaagcgatcgttcaggctaattcccggtgagaccatgactttgtggaacgccgacatc
ggcagcgaaaatccggatgtcaacctttacggatcgcacccgttttacatggatgtaaga
ggatcaaagggaaacgaggaagcagggacgactcatggggttctcttgctgaacagcaat
ggaatggatgtgaagtatgaaggacatcggataacttacaatgtgattggaggcgtcatt
gatctctatgtgttcgcgggaccatcgccggagatggtcatgaatcagtacactgagctt
attggaagacctgcccctatgccttactggtcatttggatttcaccaatgtagatatggg
tacaagaatgtatcagaccttgaatatgtagttgatggatatgcaaaagctggaatacct
cttgaggtgatgtggactgacattgattacatggatgggtacaaagacttcactttggat
cctgtaaatttcccggaggacaagatgcaatcatttgtcgatacacttcacaagaatggt
cagaaatacgtgctgatcttggatcccggtattggtgtggatagctcttatgggacatat
aatagaggaatggaagctgatgttttcataaaaagaaatggtgagccttatcttggtgag
gtttggcccggaaaagtatacttccccgacttcttgaatccagctgctgcaactttctgg
agcaacgaaatcaagatgttccaggagattctccctttggatggtctgtggattgacatg
aatgagttatcaaatttcataacttcgcctctatcctctggatcttcactcgatgatcct
ccttacaagatcaacaattcaggggataaaaggccgataaacaataagacagtacccgca
acatctatccattttggaaacattagtgaatacgatgcgcataacttgtatgggctcttg
gaagctaaagccactcaccaagctgtggtggatataacgggaaagagaccgtttattttg
tcaagatccacgtttgtaagctcggggaaatacacggctcactggactggtgataatgct
gcaaaatgggaggatttggcttactcaatccccggaatcctcaactttggcctgtttggg
attccaatggttggagctgatatttgcggtttctcacatgataccaccgaggaattatgc
cgtcgatggatccagcttggagctttttacccttttgcaagagaccattcgtcccttggt
accgccagacaagaactatacctctgggattcagttgcttcttctgcaagaaaggttctc
ggcctcagaatgagactgctcccacatctctacacattgatgtatgaggctcatgtcagc
ggcaacccaatcgcgcgcccgctcttcttctcatttcctcaagacactaaaacctatgag
attgattcccagttcttgattggtaaaagcataatggtttctccagcgctgaagcaaggg
gcggtagcagtggatgcatatttccctgctggaaattggttcgatctttttaactattcc
tttgccgttggtggagattctggcaagcacgttagacttgatactcccgctgatcacgtc
aacgttcatgttcgagaaggtagcattgtggctatgcaaggagaggcattgacgactagg
gacgccagaaagacaccgtatcagcttctagttgtagccagccggcttgagaacatctcc
ggcgaactgtttcttgatgacggagaaaatttacggatgggagctggaggaggaaaccgt
gattggacccttgttaagttccggtgctatgtgaccggaaaatccgttgtactgagatca
gaagtggtgaacccagagtatgcgtcgaaaatgaaatggagcatcgggaaagtgacgttt
gttgggttcgagaacgtggagaacgtgaaaacgtacgaggttaggacaagtgagagattg
aggagtcctagaatctctcttataaagacggtttcggacaatgatgatccgaggtttcta
agtgtggaggtttctaaactgtcgttacttgttgggaagaagttcgaaatgagactgaga
ttgacttga

DBGET integrated database retrieval system