KEGG   Arabidopsis thaliana (thale cress): AT5G17330Help
Entry
AT5G17330         CDS       T00041                                 

Gene name
GAD
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AT5G17330 (GAD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT5G17330 (GAD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G17330 (GAD)
   00430 Taurine and hypotaurine metabolism
    AT5G17330 (GAD)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT5G17330 (GAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 831599
NCBI-ProteinID: NP_197235
MIPS: AT5G17330.1
TAIR: AT5G17330
Araport: AT5G17330
UniProt: Q42521
LinkDB All DBs
Structure
PDB: 

Position
5
AA seq 502 aa AA seqDB search
MVLSHAVSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEK
TERFNIVSKDEGVPLVAFSLKDSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITVLRVV
IREDFSRTLAERLVIDIEKVMRELDELPSRVIHKISLGQEKSESNSDNLMVTVKKSDIDK
QRDIITGWKKFVADRKKTSGIC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccacgccgtatcggagtcggacgtctccgtccactccacattcgcatca
cgttacgtccgtacttcacttcctaggttcaagatgccggaaaactcgattcctaaggaa
gcggcgtatcagatcatcaacgacgagctgatgcttgacgggaatccacggttgaactta
gcctcctttgtgacgacatggatggagcctgagtgtgataaactcatcatgtcctccatc
aacaagaactatgttgacatggacgagtaccccgtcaccaccgaacttcagaaccgatgt
gtgaacatgattgcacatctattcaatgcaccgttagaagaggcggagaccgccgtcgga
gtaggaaccgttggatcatcggaggccataatgttggccggtttggccttcaagcgtaaa
tggcagaacaagcgcaaagctgaaggcaaacccgtcgataaacccaacattgtcaccgga
gccaatgttcaagtgtgttgggagaaattcgctaggtactttgaggttgaacttaaggaa
gtgaaattgagtgaaggatactatgtgatggaccctcaacaagctgttgatatggttgat
gagaacaccatttgtgttgcggccattcttggttccactcttaatggagaattcgaagat
gttaaactcttgaacgatctcttggtcgaaaagaacaaagaaaccggatgggatacacca
atccacgtggatgcggcaagtggaggattcattgcaccgtttttgtatccggaattggaa
tgggactttagacttcccttggtgaagagtatcaatgtgagtggtcacaagtatggactt
gtgtacgcagggattggttgggtgatctggagaaacaaagaggatttgcctgaggaactc
atcttccatatcaattatcttggtgctgaccaacccacctttactctcaatttctccaaa
ggttcaagtcaagtcattgctcaatactaccaacttatccgattgggccacgagggttac
agaaatgtgatggagaattgcagagagaatatgatcgtcctaagggaaggacttgagaag
acagaaaggttcaacatcgtctcaaaggacgagggagtgccacttgtcgctttctccttg
aaagatagcagctgtcacactgagttcgaaatctccgacatgcttcgcaggtatggatgg
atagtgccggcctacacaatgcctccaaatgcacaacacatcactgttcttcgtgtggtt
atcagagaagatttctcgagaacactcgctgagagacttgtgatcgatatagagaaagtg
atgcgtgagctcgatgagcttccttcgagagtgattcacaaaatatcacttggacaagag
aagagtgaatctaacagcgataacttgatggtcacggtgaagaagagcgatatcgacaag
cagagagatatcatcactggctggaagaagtttgtcgccgacaggaagaagacgagtggt
atctgctaa

DBGET integrated database retrieval system