KEGG   Arabidopsis thaliana (thale cress): AT5G19780Help
Entry
AT5G19780         CDS       T00041                                 

Gene name
TUA5
Definition
(RefSeq) tubulin alpha-5
  KO
K07374  tubulin alpha
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT5G19780 (TUA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT5G19780 (TUA5)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G19780 (TUA5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT5G19780 (TUA5)
   04147 Exosome [BR:ath04147]
    AT5G19780 (TUA5)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     AT5G19780 (TUA5)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AT5G19780 (TUA5)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AT5G19780 (TUA5)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT5G19780 (TUA5)
  Exosomal proteins of other body fluids (saliva and urine)
   AT5G19780 (TUA5)
  Exosomal proteins of colorectal cancer cells
   AT5G19780 (TUA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 832098
NCBI-ProteinID: NP_197479
MIPS: AT5G19780.1
TAIR: AT5G19780
Araport: AT5G19780
UniProt: Q56WH1 B9DHQ0 A0A178UTQ9
LinkDB All DBs
Position
5
AA seq 450 aa AA seqDB search
MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT
SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP
TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGAEGGDDEEDEGEDY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaattattagcattcatatcggacaagccgggatccaagtcggaaattcctgc
tgggagctttactgtctcgaacatggaatccagcccgacggaatgatgccgagtgatact
acagttggtgttgcacacgatgcgttcaatactttctttagcgagactggagctgggaag
catgttcctagggctgtcttcgttgatctcgagcctaccgttatcgacgaagttcgtact
ggtacttaccgtcaacttttccatccagagcagctcatttctgggaaagaagatgctgct
aacaacttcgctagaggacattacactgttggaaaggaaattgtggatctatgtcttgac
cgtgtgaggaagcttgccgacaactgtactggcttacaagggtttttggtgttcaatgct
gttggtggtggaactggttctggattgggttctctgttgctagagcgtttgtctgtagat
tacggaaagaagtctaagcttggttttaccatatacccttctcctcaggtttctactgct
gttgtagagccttacaacagtgtgctttcaacgcattcccttcttgaacataccgatgta
gctgtcctcttggataacgaagccatctatgacatttgccgcagatccctagatatcgag
aggccaacctacacaaacttgaacaggttgatatcacagatcatttcatccttgacaaca
tctttgaggtttgatggtgccatcaacgtggatatcactgagttccagaccaatcttgtc
ccatatccccgtatccatttcatgctgtcatcttatgcaccagtcatctcagccgccaag
gcttaccacgagcagctatcagtccctgagatcaccaatgccgtgtttgagccagcgagc
atgatggcaaagtgtgacccaaggcacggaaagtacatggcatgttgtttgatgtaccga
ggagatgttgttcccaaagatgttaatgctgccgttggcaccatcaagacaaagaggact
gttcagtttgttgactggtgcccaactgggttcaaatgtggaatcaactaccaacctcca
acagttgttccaggtggtgacctcgctaaggttcagagagctgtatgcatgatcagtaac
aacacagcagttgcagaggtgttctcacggatcgaccacaagtttgatctcatgtatgcg
aagagggcattcgtgcactggtacgttggtgaaggaatggaggaaggtgaattctctgag
gcacgtgaagacttggccgcactggagaaagactacgaagaagttggtgctgaaggtgga
gacgatgaagaagatgaaggtgaagactattga

DBGET integrated database retrieval system