KEGG   Arabidopsis thaliana (thale cress): AT5G23860Help
Entry
AT5G23860         CDS       T00041                                 

Gene name
TUB8
Definition
(RefSeq) tubulin beta 8
  KO
K07375  tubulin beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT5G23860 (TUB8)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AT5G23860 (TUB8)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AT5G23860 (TUB8)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT5G23860 (TUB8)
  Exosomal proteins of colorectal cancer cells
   AT5G23860 (TUB8)
  Exosomal proteins of bladder cancer cells
   AT5G23860 (TUB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Motif
Other DBs
NCBI-GeneID: 832451
NCBI-ProteinID: NP_001190373
MIPS: AT5G23860.1
TAIR: AT5G23860
Araport: AT5G23860
UniProt: P29516 A0A178UKM5
LinkDB All DBs
Position
5
AA seq 449 aa AA seqDB search
MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV
PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSTVCDIPPTG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEEGYEYEEDEVEVQEEQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgagagattcttcacatacaaggtggccaatgcggaaaccagatcggagctaagttc
tgggaagtagtttgcgccgagcacgggatcgattcgacgggaagataccaaggagagaac
gatttgcaactcgaacgagtcaatgtctactacaacgaagcgagttgcggaagattcgtc
ccacgcgccgtcctcatggatctagagcctggtactatggatagtgtcagatccggtccg
tacggtcagatcttccgtcctgataacttcgtatttggtcaatccggtgccggtaacaat
tgggctaaaggacactacactgaaggtgctgagcttatcgattccgttctcgatgttgtt
cgtaaggaagctgagaattgtgactgcttgcaaggattccaagtgtgtcactcattagga
ggaggaactggatctggaatgggaacgttgttgatttcaaagattagggaagagtatcca
gataggatgatgctgacgttttctgtattcccatcaccgaaagtgtcagacactgttgtt
gagccttataatgcaactctctctgttcatcagcttgtggagaatgcagatgagtgtatg
gttcttgacaatgaagctctctatgacatttgcttcagaactcttaagctcaccactcca
agctttggagacttgaatcacctcatctctgcaaccatgagtggtgtcacttgctgcctt
cgtttcccgggtcagctaaactctgacctgcgcaagcttgcagtgaatttaatcccattc
cctcgtctccacttcttcatggttgggtttgcaccactcacatctcgtggatcacagcaa
tacagagccttaaccgtccctgagctcactcaacagatgtgggatgccaagaatatgatg
tgtgcagctgatccacgccacggcaggtacttgacagcctcagccatgttcagaggcaaa
atgagcacgaaagaagttgacgaacagatgatcaacgttcagaacaagaactcgtcatac
tttgtggaatggatcccaaacaacgtgaaatcaaccgtgtgtgacattccaccaacaggt
ctgaaaatggcttcgactttcatcgggaactcgacatcgatccaggagatgtttaggcgt
gtgagcgaacagttcacagcgatgttcagaagaaaagctttcttgcattggtacacaggt
gaaggaatggacgagatggagttcacagaggcagagagcaacatgaatgatttggtatca
gagtatcaacagtaccaagacgcaacggctgatgaggaagaagggtatgagtatgaagaa
gacgaagtggaagtgcaggaggagcaataa

DBGET integrated database retrieval system