KEGG   Arabidopsis thaliana (thale cress): AT5G38120Help
Entry
AT5G38120         CDS       T00041                                 

Gene name
4CL8
Definition
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K10526  OPC-8:0 CoA ligase 1 [EC:6.2.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    AT5G38120 (4CL8)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     AT5G38120 (4CL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 833792
NCBI-ProteinID: NP_198628
MIPS: AT5G38120.1
TAIR: AT5G38120
Araport: AT5G38120
UniProt: Q84P26
LinkDB All DBs
Position
5
AA seq 550 aa AA seqDB search
MANSQRSSSLIDPRNGFCTSNSTFYSKRKPLALPSKESLDITTFISSQTYRGKTAFIDAA
TDHRISFSDLWMAVDRVADCLLHDVGIRRGDVVLVLSPNTISIPIVCLSVMSLGAVLTTA
NPLNTASEILRQIADSNPKLAFTTPELAPKIASSGISIVLERVEDTLRVPRGLKVVGNLT
EMMKKEPSGQAVRNQVHKDDTAMLLYSSGTTGRSKGVNSSHGNLIAHVARYIAEPFEQPQ
QTFICTVPLFHTFGLLNFVLATLALGTTVVILPRFDLGEMMAAVEKYRATTLILVPPVLV
TMINKADQIMKKYDVSFLRTVRCGGAPLSKEVTQGFMKKYPTVDVYQGYALTESNGAGAS
IESVEESRRYGAVGLLSCGVEARIVDPNTGQVMGLNQTGELWLKGPSIAKGYFRNEEEII
TSEGWLKTGDLCYIDNDGFLFIVDRLKELIKYKGYQVPPAELEALLLNHPDILDAAVIPF
PDKEAGQFPMAYVARKPESNLCEKKVIDFISKQVAPYKKIRKVAFIDSIPKTPSGKTLRK
DLIKFAISKI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattctcaaagatcatcatctctgatcgatccaaggaacggtttctgcacatca
aactccacattttacagtaaacgcaaaccattggcacttccttcaaaagaatcactcgac
atcacaacattcatctcctcccaaacgtaccgtggcaaaaccgccttcatagacgcagcc
acggaccaccgcataagcttctccgatttatggatggccgtggatcgtgtcgccgactgt
ctcctccacgacgtgggaatacggagaggtgacgtggtcctagtcctctctcccaacacc
atctccatccccattgtctgcctctccgtgatgtctcttggcgctgtcttaactaccgct
aatcctctcaacaccgctagtgaaatcttaagacaaatcgcggatagcaatccaaaactc
gccttcacaacaccggaactggctcccaaaatcgccagttccggtatctctatcgtcctc
gagcgcgtagaagacactctacgcgttccgagaggactcaaagtggttgggaatctaact
gaaatgatgaagaaagaaccaagtggacaagcagtcagaaaccaagttcataaagacgac
acggcgatgttgctttactcctcggggacgacgggacgaagcaaaggagtgaattcgtct
cacgggaacttaatagcacacgtggcgagatacatcgcggagccattcgagcagccacaa
cagaccttcatttgcactgttccgttgttccacacttttggtttactaaacttcgttttg
gccaccttagcgttaggtacgaccgttgtcatcctcccgaggtttgacctcggagagatg
atggcggctgtcgagaaatacagagcgacgactctgattctcgtgccgccagttttagta
actatgataaacaaagcggatcaaataatgaagaagtacgacgtgagcttcttgagaacg
gtgcggtgcggtggagcacctttgagcaaggaagttactcaagggtttatgaagaaatat
ccaacggttgatgtttatcaaggatacgcattgacggaatctaacggtgcaggagcttcg
atagaatcagtggaggagagtcggaggtacggtgcggtggggttgttgtcatgtggtgta
gaagcgaggattgtggatccgaatacgggtcaggtcatgggtttgaaccaaacgggcgaa
ctttggcttaaagggccttctatcgccaaaggttatttcaggaatgaagaagaaattata
acttcagaaggatggcttaaaacaggagatctatgctatatagacaacgatggatttctt
tttatcgttgatcgattgaaagagcttatcaaatacaaaggttaccaggtacctccagct
gaactagaggctctcttactaaaccatccagatattctcgatgcagccgttattccgttt
ccagataaagaagcaggacaatttccgatggcttacgtagcacgaaagcctgagagtaat
ctttgtgagaaaaaggttatcgactttatttctaaacaggtggcaccatataagaaaata
agaaaagtcgcatttatagactctataccaaagactccatcgggcaaaacacttcgcaag
gatctaatcaaatttgccatttcaaaaatttaa

DBGET integrated database retrieval system