KEGG   Arabidopsis thaliana (thale cress): AT5G44340Help
Entry
AT5G44340         CDS       T00041                                 

Gene name
TUB4
Definition
(RefSeq) tubulin beta chain 4
  KO
K07375  tubulin beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT5G44340 (TUB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G44340 (TUB4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT5G44340 (TUB4)
   04147 Exosome [BR:ath04147]
    AT5G44340 (TUB4)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AT5G44340 (TUB4)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AT5G44340 (TUB4)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT5G44340 (TUB4)
  Exosomal proteins of colorectal cancer cells
   AT5G44340 (TUB4)
  Exosomal proteins of bladder cancer cells
   AT5G44340 (TUB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Motif
Other DBs
NCBI-GeneID: 834459
NCBI-ProteinID: NP_199247
MIPS: AT5G44340.1
TAIR: AT5G44340
Araport: AT5G44340
UniProt: P24636 A0A178UGW7
LinkDB All DBs
Position
5
AA seq 444 aa AA seqDB search
MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGQYVGDSPLQLERIDVYFNEASGGKYV
PRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENSDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLANPTFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYSALSVPELTQQMWDAKNMM
CAADPRHGRYLTASAVFRGKLSTKEVDEQMMNIQNKNSSYFVEWIPNNVKSSVCDIAPKG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVA
EYQQYQDATAGEEEYEEEEEEYET
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatccttcatatccaaggcggtcaatgtggaaaccagatcggagcaaagttc
tgggaagtgatctgcgacgaacacggcattgatcacaccggtcaatacgtcggcgattct
ccgttacagcttgaacgtatcgatgtctatttcaacgaagctagcggtggaaagtacgtt
cctcgcgctgttcttatggatctggagcctggtaccatggattctctcagatctggtccg
ttcggtcagattttccgtcctgataacttcgtctttggtcaatctggtgccggaaataac
tgggcgaaaggtcattacaccgaaggtgctgagttgattgattctgttctcgatgttgtg
aggaaggaagctgagaacagcgattgtcttcaaggtttccaagtgtgtcattcattggga
ggaggaactggatctggaatgggaactctattgatttctaagataagagaagagtatcca
gatcgtatgatgatgactttctcagtgtttccttctcctaaggtctctgacactgttgtt
gagccatacaatgcaactctctctgtgcatcagcttgtcgaaaacgctgacgagtgtatg
gttttggacaatgaggctctctacgatatctgtttccgtaccctcaagctcgctaatcct
acctttggtgatcttaaccatctcatctctgctacaatgagtggtgtcacttgctgtctt
cgtttccctggccagcttaactctgaccttaggaaactcgctgtgaaccttatcccattc
ccaaggcttcacttcttcatggttggtttcgcaccattgacatcgagaggatcacagcaa
tacagtgccttgagtgttcctgaactgacccagcagatgtgggatgcaaagaacatgatg
tgtgctgctgaccctcgtcatggacgttacttgactgcatccgctgtgttccgtggaaag
ctgagcaccaaagaggttgacgagcagatgatgaacattcagaacaagaactcatcctac
tttgtggaatggatcccaaacaacgtcaagtccagtgtctgtgatattgcaccaaagggt
ttgaaaatggcgtctactttcattggtaactcaacctcaatccaggagatgtttaggcgt
gtgagcgaacagttcacagctatgttcaggagaaaggctttccttcattggtacacagga
gaaggcatggacgagatggagttcactgaagcagagagtaacatgaatgatcttgtcgca
gagtaccagcagtaccaagatgctacagccggagaggaagagtacgaggaggaagaagag
gagtacgagacttaa

DBGET integrated database retrieval system