KEGG   Arabidopsis thaliana (thale cress): AT5G47320
Entry
AT5G47320         CDS       T00041                                 
Symbol
RPS19
Name
(RefSeq) ribosomal protein S19
  KO
K02965  small subunit ribosomal protein S19
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT5G47320 (RPS19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT5G47320 (RPS19)
Ribosome [BR:ath03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    AT5G47320 (RPS19)
  Archaea
    AT5G47320 (RPS19)
SSDB
Motif
Pfam: Ribosomal_S19 RRM_1 RRM_7 DnaI_N
Other DBs
NCBI-GeneID: 834779
NCBI-ProteinID: NP_568681
TAIR: AT5G47320
UniProt: P39697 A0A178UHZ5
Structure
LinkDB
Position
5:19203052..19205285
AA seq 212 aa
MAFCTKLGGHWKQGVNVPVSSMLGSLRYMSTKLYIGGLSPGTDEHSLKDAFSSFNGVTEA
RVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNISVNVAKDWPSLPLSLDES
IEEAEKKENKMMSRSVWKDPFVDAFLMKKKNAALNRKIWSRRSTILPEYVDSAVRIYNGK
THVRCKITEGKVGHKFGEFAFTRKVKKHAKAK
NT seq 639 nt   +upstreamnt  +downstreamnt
atggctttctgcactaaacttggcggtcactggaaacaaggggtaaatgttccagtgtca
tcaatgctcggttctcttcgctacatgtccacaaaactttatattggtggcctgtcccct
ggaactgacgagcactccttgaaggacgctttctctagcttcaatggagtgacagaggca
agagtcatgacaaacaaagtgaccgggaggtctagaggttatggatttgttaacttcata
agcgaggattctgccaactctgctatttcagcaatgaatggacaggagctgaatgggttt
aacataagtgtgaacgttgcaaaagattggccaagtttgccattgtctttggatgagagt
atagaagaagctgagaagaaagaaaataagatgatgagccgatctgtatggaaagatcca
ttcgttgatgcgttcctgatgaagaagaagaatgcagctctgaacaggaaaatatggtca
aggagatcgacgattcttcccgagtatgttgattcggcggtgagaatctacaacggcaaa
actcatgtgcgttgtaagatcacagaggggaaagttgggcataaattcggagagtttgcg
tttacaagaaaagtgaagaagcatgctaaagcaaagtag

DBGET integrated database retrieval system