KEGG   Arabidopsis thaliana (thale cress): AT5G48545
Entry
AT5G48545         CDS       T00041                                 

Symbol
HINT3
Name
(RefSeq) histidine triad nucleotide-binding 3
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: HIT DcpS_C CwfJ_C_1
Other DBs
NCBI-GeneID: 2746201
NCBI-ProteinID: NP_974907
TAIR: AT5G48545
UniProt: F4K1R2 A0A178UAY8
LinkDB
Position
5:19675452..19678194
AA seq 197 aa
MEARRLAILCSHLNPPGPNPTRDPTLRVSDCSSGSSGDGKVESSTLQNDCVFCKIIRGES
PCLKLYEDDMCLCILDTNPLSHGHSLIIPKLHYPTLEETPPSVVAAMCSKVPLISNAIVK
ATGSDSFNLLVNNGAAAGQVIFHTHIHIIPRKERDCLWASESLRRHSLKLDKEASQLVSC
VRRHLCSLPEEQLVQPS
NT seq 594 nt   +upstreamnt  +downstreamnt
atggaagctagaagactcgcgatcctctgttctcacctgaacccacctggtccgaacccg
acccgagacccgactctcagggtctccgattgtagctctggttcttccggcgacgggaaa
gtggaatcatctactctccaaaacgactgcgttttctgcaagattatccgtggcgagtct
ccatgtctcaagttgtacgaggatgatatgtgtttgtgtattctggatactaatccacta
agtcatgggcactctcttatcattccaaagttacattatccaaccttagaggaaactcct
ccctcagttgttgctgccatgtgttctaaagtgcctcttatcagtaacgccatcgtgaaa
gctaccgggagtgactcatttaacttattggttaacaacggcgcagcagctggacaagtc
atatttcacacacacattcacataatcccgcgtaaggaacgtgactgcttatgggcttcc
gagagcttacggagacactctctgaaacttgacaaggaagcatctcaactggtatcgtgt
gttcgacgacacttgtgcagccttcctgaagaacaactggttcaaccctcgtaa

DBGET integrated database retrieval system