KEGG   Arabidopsis thaliana (thale cress): AT5G62690Help
Entry
AT5G62690         CDS       T00041                                 

Gene name
TUB2
Definition
(RefSeq) tubulin beta chain 2
  KO
K07375  tubulin beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT5G62690 (TUB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G62690 (TUB2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT5G62690 (TUB2)
   04147 Exosome [BR:ath04147]
    AT5G62690 (TUB2)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AT5G62690 (TUB2)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AT5G62690 (TUB2)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT5G62690 (TUB2)
  Exosomal proteins of colorectal cancer cells
   AT5G62690 (TUB2)
  Exosomal proteins of bladder cancer cells
   AT5G62690 (TUB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_2 Misat_Tub_SegII Tubulin_3
Motif
Other DBs
NCBI-GeneID: 836390
NCBI-ProteinID: NP_568959
MIPS: AT5G62690.1
TAIR: AT5G62690
Araport: AT5G62690
UniProt: Q56YW9 Q9ASR0 A0A178UP81
LinkDB All DBs
Position
5
AA seq 450 aa AA seqDB search
MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV
PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQMWDSKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEGDYEDEEEGEYQQEEEY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagattcttcacatccagggtggtcaatgcggtaaccagatcggcgccaagttc
tgggaagtggtttgcgccgagcacggcatcgatccaaccggaaggtacaccggagactca
gatctgcaacttgagcgcatcaacgtttactacaatgaagcgagttgcggtagattcgtt
cctcgtgcagtgctcatggatttggagcctgggactatggatagtctcagatctggaccg
tacggtcagacctttcgacctgataacttcgtctttggccaatccggtgctggtaacaac
tgggccaagggacactacacggaaggagctgaactaatcgattccgttctcgatgttgtt
cgtaaggaagctgagaactgtgactgtctccaagggttccaggtttgtcactcgttggga
ggaggaactggatctggtatgggaacattgttgatctctaagatccgtgaagagtaccca
gatcgcatgatgcttaccttctcggtgttcccttcaccaaaggtttctgatactgtggtt
gagccttacaacgctactctgtctgtccatcagcttgttgagaatgctgatgagtgcatg
gttcttgataatgaggccttgtacgatatttgcttcaggactctcaaactcactaccccc
agctttggtgatttgaaccacttgatttctgctactatgtctggtgtgacttgctgtctg
aggttccctggtcaactcaactctgacctccgaaagcttgctgtgaatctcatcccattc
ccccgtcttcacttcttcatggtgggttttgctcctctcacctcaagaggttctcagcag
taccgttccctcacagtccctgagctcacccagcaaatgtgggactccaagaacatgatg
tgtgctgcagacccaaggcacggacgctacctcacagcctctgccatgttccgtggcaag
atgagcacaaaggaagttgacgagcagatgctgaatgtgcagaacaagaactcgtcctac
tttgtggagtggatccccaacaacgtgaaatcgacagtctgtgacatcccacctactggt
ctgaagatggcatcaactttcattggaaactcaacatcaatccaagagatgttcaggcga
gtgagtgagcagttcacagctatgttcaggagaaaggctttcttgcattggtacacaggt
gagggaatggacgagatggaattcacagaagcggagagcaacatgaacgatcttgtgtca
gagtaccagcaataccaagatgcaactgcggatgaagaaggtgactacgaggatgaggaa
gaaggtgaatatcaacaggaggaagagtactga

DBGET integrated database retrieval system