KEGG   Arabidopsis thaliana (thale cress): AT5G66760Help
Entry
AT5G66760         CDS       T00041                                 

Gene name
SDH1-1
Definition
(RefSeq) succinate dehydrogenase 1-1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00020  Citrate cycle (TCA cycle)
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT5G66760 (SDH1-1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT5G66760 (SDH1-1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AT5G66760 (SDH1-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 836809
NCBI-ProteinID: NP_201477
MIPS: AT5G66760.1
TAIR: AT5G66760
Araport: AT5G66760
UniProt: O82663 A0A178UAN3
LinkDB All DBs
Position
5
AA seq 634 aa AA seqDB search
MWRCVSRGFRAPASKTSSLFDGVSGSRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACA
ADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMASDGSCQGVIALNMEDGTLHRFRSSQ
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHL
PPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDA
VIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGE
KTIAWLDRLRNSNGSLPTSTIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQ
VKDRSMIWNSDLIETLELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTL
GYWEDEKVRLDYRPVHMDTLDDEIDTFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtctctcgtggctttcgagctcctgcttcaaagacctcttcactcttt
gatggcgtctctggatctcgcttttccagattcttctccactggttctaccgatacgaga
tcctcttatacgatagtggatcacacttatgatgcggttgtggtgggagctggtggtgct
ggtcttagggcggcgattgggttatcggagcatggctttaacaccgcttgcattactaag
cttttccccacaaggtcacatactgttgctgctcagggtggtattaatgctgcactggga
aatatgtccgaagatgactggagatggcacatgtatgacactgtcaaaggaagtgactgg
ctaggtgatcaagatgctatccagtacatgtgtagagaggcaccaaaagcagtcattgaa
cttgagaattatgggctgcctttctctcgtactgaagaagggaaaatttaccagcgtgca
tttggtggtcagagtcttgactttggaaaaggtggtcaggcctatcgttgtgcttgtgct
gcggataggactggtcatgctctgttgcatactctctatggacaagctatgaagcataac
acacagttctttgttgaatacttcgccttggatctgctcatggctagtgatggcagttgc
cagggtgtaattgcactaaacatggaagatggaacattgcatcgtttccgttcttctcaa
acaattttggcaactggggggtacggcagagcatacttctctgcaacctcagcacataca
tgcacaggggatggaaatgcaatggttgcacgggccggtcttccactgcaggacttggag
tttgttcaattccatccaactggtatatatggggccggatgtctcatcaccgaaggatct
cgaggtgaaggtggtatccttagaaacagtgaaggtgaacgttttatggaacgatatgct
cctacagccaaggatcttgcatcaagagatgttgtctccagatccatgactatggaaatc
agggaaggtcgtggtgtaggaccgcataaggatcatatctatctccatctgaatcatctt
cctccagaagttctaaaagaaaggcttcctggaatctctgagaccgctgccatctttgct
ggtgttgatgttaccaaagagccaattcctgtcttacccacggttcattataacatgggt
ggtatcccaacaaactaccatggcgaggtagttaccatcaaaggcgatgatccagatgca
gtgattcctgggctaatggctgctggggaggcagcttgtgcatctgttcatggtgccaac
aggcttggtgcaaattcactgctcgacattgtcgtatttggtcgtgcttgtgcaaatagg
gttgcagagataagcaaaccaggggagaaacagaaacctcttgagaaggatgcgggtgag
aagactattgcatggctggacaggttgagaaactcaaacgggtctctacctacttcaact
atcagattgaacatgcagaggattatgcagaacaacgcagctgtgttccgcacgcaagaa
acattggaagaaggttgtcagttgattgacaaggcctgggaaagttttggggacgtccag
gtgaaagatcggagtatgatatggaactcggatttgatagagacattggaactggagaac
cttttgataaacgcatccataacaatgcattcagcagaagcacgaaaggaaagcagagga
gcacatgctcgggaagacttcacgaaaagagaggatggagaatggatgaagcatacattg
ggatattgggaagatgagaaagtgagattggattataggcctgttcacatggacactctc
gacgatgagatcgacactttccctcccaaagctcgtgtctattga

DBGET integrated database retrieval system