KEGG   Arabidopsis thaliana (thale cress): ArthCp030Help
Entry
ArthCp030         CDS       T00041                                 

Gene name
rbcL
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Module
ath_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ath_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ath_M00532  Photorespiration
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ArthCp030 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ArthCp030 (rbcL)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ArthCp030 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 844754
NCBI-ProteinID: NP_051067
TAIR: ATCG00490
UniProt: O03042 A0A1B1W4U8
LinkDB All DBs
Structure
PDB: 

Position
CP
AA seq 479 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAVEGNEIIREACKWSPELAAACEVWKEITFNFPTIDKLDGQE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttgggttcaaagctggtgttaaagagtat
aaattgacttactatactcctgaatatgaaaccaaggatactgatatcttggcagcattc
cgagtaactcctcaacctggagttccacctgaagaagcaggggctgcggtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagccttgatcgttac
aaaggacgatgctaccacatcgagcccgttccaggagaagaaactcaatttattgcgtat
gtagcttatcccttagacctttttgaagaaggttcggttactaacatgtttacctcgatt
gtgggtaatgtatttgggttcaaagccctggctgctctacgtctagaggatctgcgaatc
cctcctgcttatactaaaactttccaaggaccacctcatggtatccaagttgaaagagat
aaattgaacaagtatggacgtcccctattaggatgtactattaaaccaaaattggggtta
tccgcgaaaaactatggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgagaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaatcacaggctgaaacaggtgaaatcaaagggcattatttg
aatgctactgcgggtacatgcgaagaaatgatcaaaagagctgtatttgccagagaattg
ggagttcctatcgtaatgcatgactacttaacagggggattcaccgcaaatactagtttg
tctcattattgccgagataatggcctacttcttcacatccaccgtgcaatgcacgctgtt
attgatagacagaagaatcatggtatgcacttccgtgtactagctaaagctttacgtcta
tctggtggagatcatattcacgcgggtacagtagtaggtaaacttgaaggagacagggag
tcaactttgggctttgttgatttactgcgcgatgattatgttgaaaaagatcgaagccgc
ggtatctttttcactcaagattgggtctcactacctggtgttctgcctgtggcttcaggg
ggtattcacgtttggcatatgcctgctttgaccgagatctttggagatgattctgtacta
caattcggtggaggaactttaggccacccttggggaaatgcaccgggtgccgtagccaac
cgagtagctctggaagcatgtgtacaagctcgtaatgagggacgtgatcttgcagtcgag
ggtaatgaaattatccgtgaagcttgcaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaagagatcacatttaacttcccaaccatcgataaattagatggccaagagtag

DBGET integrated database retrieval system