KEGG   Azospirillum thiophilum: AL072_00350Help
Entry
AL072_00350       CDS       T04091                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ati  Azospirillum thiophilum
Pathway
ati00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AL072_00350
Enzymes [BR:ati01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AL072_00350
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AL072_00350
    1.1.1.-  
     AL072_00350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C DAO 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ALG71863
UniProt: A0A0F2L1B4
LinkDB All DBs
Position
1:81290..82396
Genome map
AA seq 368 aa AA seqDB search
MKAAVWHGRKDIRVEDVPLPGAPPAGWVQIKVHWCGICGSDLHEYVAGPVFIPVDKPHPL
TGLKGQCILGHEFSGEIAALGDGVTGFTVGDRVAADACQHCGECYYCKHGMYNICERLAF
TGLMNNGAFASLVNVPAELLYRLPDGFPTEAGALIEPLAVGMHAVKKAGSIVGETVVVVG
AGTIGLCTIMCAKAAGAGRIIVLEMSAARKAKAMEVGATVVLDPKECDAVAEVKALTGGY
GADVSFECIGHRDTAKLAIDVIRKAGKAVLVGIFEEPSSFNFFEIVATEKQVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALDDIVSGGFEELVAHKDRNVKIIVQPGQPGRVAAL
AAEPELVH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcacggccgcaaggacatccgggtcgaggacgtgccgctgccg
ggcgcgccgcccgccggctgggttcagatcaaggtgcattggtgcggcatctgcgggtcc
gacctgcatgaatatgtcgccggcccggtcttcatcccggtcgacaagccccatccgctg
accggcctgaagggccaatgcatcctgggccacgagttcagcggcgagatcgcggcgctg
ggcgacggcgtgaccggcttcaccgtcggcgaccgggtggcggccgacgcctgccagcat
tgcggcgagtgctattattgcaagcacggcatgtacaacatctgcgagaggctggccttc
accggcctgatgaacaacggcgccttcgccagcctggttaatgtcccggcggaactgctc
tacaggctgcccgacggcttcccgaccgaggccggcgccctgatcgagccgctggcggtc
ggcatgcacgcggtgaagaaggccggcagcatcgtcggcgagacggtggtggtggtcggc
gccggcaccatcggcctctgcaccatcatgtgcgcgaaggcggcgggagccgggcggatc
atcgtgctggagatgtccgccgcccgcaaggccaaggcgatggaggtcggcgcgacggtc
gtgctcgaccccaaggaatgcgacgcggtggcggaggtcaaggcgctgaccggcggttac
ggcgccgacgtgtcgttcgaatgcatcgggcaccgcgacacggcgaagctcgccatcgac
gtcatccgcaaggccggcaaggcggtgctggtcggcatcttcgaggaaccgagctccttc
aacttcttcgagatcgtcgccaccgagaagcaggtcatcggctcgctggcctacaatggc
gagttcgccgacgtcatccgcttcatcgccgacggccggatcgacgtgcagccgctgatc
accggccgcatcgcgctggacgacatcgtctcgggcgggttcgaggagctggtggcccac
aaggaccgcaacgtcaagatcattgtccagcccggccagcccggccgggtcgccgcgctc
gccgcagagccggagctcgtccactga

DBGET integrated database retrieval system