KEGG   Azospirillum thiophilum: AL072_08090Help
Entry
AL072_08090       CDS       T04091                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
ati  Azospirillum thiophilum
Pathway
ati00340  Histidine metabolism
ati01100  Metabolic pathways
ati01110  Biosynthesis of secondary metabolites
ati01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AL072_08090
Enzymes [BR:ati01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     AL072_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG EF-hand_8
Motif
Other DBs
NCBI-ProteinID: ALG70881
UniProt: A0A0F2KYL5
LinkDB All DBs
Position
1:1740482..1740808
Genome map
AA seq 108 aa AA seqDB search
MTDDLIRLYGAILDRRSMDPAESKTARLIAAGPKKIAKKVGEEAVEVALDAMNEDRQGVI
NESADLLYNLSVLWATLDIHPDDVFAEIRRREALYGIAEKLPKTTPDR
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacctgatccgcctctatggtgccatcctcgaccgccggagcatggacccg
gcggaatccaagaccgcaaggctgatcgccgcgggtccgaagaagatcgccaagaaggtg
ggcgaggaggcggtcgaggtggcgctggatgccatgaacgaggatcgccagggcgtcatc
aacgaaagcgccgacctgctttacaacctgtcggtcctgtgggcgacgctggacatccac
cccgacgacgtcttcgccgaaatccgccggcgcgaggcgctgtacggcatcgccgagaag
ctgccgaagaccacgcccgacaggtga

DBGET integrated database retrieval system