KEGG   Azospirillum thiophilum: AL072_08915Help
Entry
AL072_08915       CDS       T04091                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ati  Azospirillum thiophilum
Pathway
ati00500  Starch and sucrose metabolism
ati01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL072_08915
Enzymes [BR:ati01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL072_08915
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AL072_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ALG71013
UniProt: A0A0F2KY78
LinkDB All DBs
Position
1:1925618..1927300
Genome map
AA seq 560 aa AA seqDB search
MIRDLWYKNAVIYNLSLASFMDANGDGVGDFQGLLRRLDYLHGLGVTCLWLGPFQTSPMQ
DDGYDVADYYNVDPRYGTLGDFVEFTHACEQRGIRVIIDLVINHTSDRHPWFQEARSDPD
SRCRDWYVWSDKKPDNADQGMVFPGVQKTTWTYDREARAWYFHRFYKFQPDLNTAHPEVQ
AELLKIMGFWIQLGVAGFRMDAVPFIIAEKGPAVTEPREQFGMLRSFREFVQWRRGDAVL
LAEANILPEDDLEYFGSDGDRCHMMFNFQVNQHLFYALATADTEPLAKALETTKPRPATA
QWGIFLRNHDELDLGRLTEEQRQAVFAAFGPDKTMQLYDRGIRRRLAPMLHDDRRRIELA
YSLMFTLPGTPVIRYGDEIGMGDDLSLPERNCARTPMQWSDEPHGGFTKSGEPEMPVITG
GVFGYERVNAAVQRRDPQSLLNWTERIIRMRKECPEIGWGDFRILTTGRREVLAMRYDWR
NNGVVVLHNLSDKPCEILLDVEGHGEACRLVNLLSEDHSEPDSEGRHRLVMEAYGYRWFR
VGGLDYLLRRTEAVETPGDG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggacctctggtacaagaatgcggtgatctacaacctgtcgcttgccagcttc
atggatgccaacggcgacggcgtcggcgatttccagggtctgctgcggcggctggactat
ctgcacgggctgggggtgacctgcctgtggctggggccgttccagacgtcgccgatgcag
gacgacggctatgacgtcgccgactactacaacgtcgatccgcgctacggcacgctgggc
gacttcgtggagttcacccacgcctgcgagcagcgcggcatccgggtcatcatcgatctg
gtgatcaaccacacctccgaccggcatccctggttccaggaagcgcgcagcgatcccgac
agcagatgccgcgactggtatgtctggtccgacaagaagccggacaacgccgaccagggc
atggtctttcccggcgtgcagaagacgacctggacctacgaccgcgaggcgcgggcctgg
tatttccaccgcttctataaattccagcccgacctgaacaccgcccatccggaggtgcag
gcggagctgctgaagatcatgggcttctggatccagctgggcgtcgccgggttccgcatg
gacgcggttcccttcatcatcgccgagaaggggccggcggtgacggagcctcgggaacag
ttcggcatgctgcgcagcttccgcgaattcgtgcagtggcgacgcggcgacgcggtgctg
ctggcggaggccaacatcctgccggaagacgatctggaatatttcggcagcgacggcgac
cgctgccacatgatgttcaatttccaggtcaaccagcatctgttctacgcgctggccacc
gccgacaccgaaccgctggccaaggcgctggagacgacgaagccgcgcccggcgaccgcg
cagtggggcatcttcctgcgcaaccacgatgaactcgacctcggccgcctgacggaggag
cagcgtcaggccgtgttcgccgccttcggccccgacaagaccatgcagctctatgaccgc
ggcatccggcggcggctggcgccgatgctgcacgacgaccggcggcggatcgagctggcc
tacagcctgatgttcaccctgccgggaaccccggtcatccgctatggcgacgagatcggc
atgggcgacgacctgtcgctgccggaacgcaactgcgcccgcacgccgatgcaatggtcg
gacgagccgcatggcggcttcaccaagtccggcgagccggagatgccggtcatcaccggc
ggtgtgttcggctatgagcgggtgaatgccgcggtacagcgccgcgatcctcaatcgctg
ttgaactggaccgagcgcatcatccgcatgcgcaaggaatgtccggagatcggctggggc
gacttccggatcctgacgaccggccggcgggaggtgctcgccatgcgctatgactggcgc
aacaacggggtcgtcgtgctgcacaacctgtcggacaagccctgcgagatcctgctggac
gtcgaggggcacggcgaggcctgccggctggtcaatctgctgtcggaggaccacagcgag
cccgattccgaaggccgccatcgcctggtgatggaggcctacggctatcgctggttccgg
gtcggcgggctggactacctgctgcgccggaccgaggcggtggagacgccgggcgacggc
taa

DBGET integrated database retrieval system