KEGG   Azospirillum thiophilum: AL072_10765Help
Entry
AL072_10765       CDS       T04091                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ati  Azospirillum thiophilum
Brite
KEGG Orthology (KO) [BR:ati00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ati01001]
    AL072_10765
Enzymes [BR:ati01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AL072_10765
Protein kinases [BR:ati01001]
 Serine/threonine kinases: Other
  Bacterial family
   AL072_10765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ALG71307
UniProt: A0A0F2KU55
LinkDB All DBs
Position
1:complement(2327007..2329049)
Genome map
AA seq 680 aa AA seqDB search
MPDGAVAATLPGPIGPYRVEGVLGQGAMSVVYRATDGRDGRPVALKLLRGELLAAAERNA
VLTRFAREAQIGLKLDHPNIVRVHDYGTLDAAQGGAPYLAMELIRGRELKQYLEADRPLS
IQQGGTLMAAVLDALAFAHARNVIHRDIKPANIVVEDDLTPKLADFGIAQISSSDLTQAG
DLLGTPAYMAPEVLRGEKADPRSDLFSAGVVLYYLLAQRRPFSGSVATVMQQILFVEPPP
PSHANPDLPPPFDGLILKALAKTPGDRFASAGEFADALRRALAVAGTMQAPAPSAELTLF
GTELPDIAPPLDRNALLAALETALRAIPGQPIDARRLEELLGMLADWQAGGEQATSAGEL
QRWQSLLLGAGIEPLTELIVAAAPAPRAAPASQRRDWMPLVRLFAALNRALAGTPAADRA
RMSAARIAFDLSGRFFLYSGELNRVLMDGDNPDIQMLSLDFLRLELLQHALEELGAEAEL
AQSRSAMLMFAVQVIRKVTQILRACTDGNDGLARFGVAIILANIEELIVMAQRLFETGGQ
ATGGLPQDAVAEFIAAAGRFASLSVEELRGEVAQGNLAGGNMAGSADSFAARLRGVGQLY
LFATRLTAPDCAPMMHSLSTMLYGLVAGLTADLGNAPVSDTGARARLVALADMASGLGWS
EVERIALTALRRWAVAGVTA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacggcgctgtagccgcgacactccccggccccatcggcccctaccgggtcgag
ggcgtgcttggccagggcgccatgagcgtggtgtaccgcgccaccgacgggcgcgacggc
cggccggtggcgctgaagctgctgcgcggcgagctgctggccgcagcggaacgcaacgcc
gtgctgacccgcttcgcgcgcgaggcgcagatcggcctgaagctcgaccatccgaacatc
gtgcgggtgcatgactacggcacgctggacgcggcccagggcggcgccccctacctcgcc
atggagctgatccgcgggcgggagctgaagcagtatctggaggccgaccggccgctgtcg
atccagcagggcggcaccctgatggcggcggtgctggacgcgctggccttcgcccatgcc
cgcaacgtcatccaccgcgacatcaagccggccaacatcgtggtcgaggacgacctgacg
ccgaagctggccgatttcggcatcgcgcagatctcgtcgtccgacctgacccaggccggc
gacctgctgggaacccccgcctacatggcgccggaggttctgcgcggcgagaaggccgac
ccgcgcagcgacctgttctcggccggcgtggtgctctactacctgctggcgcagcggcgg
cccttctccggctcggtcgccacggtgatgcagcagatcctgttcgtcgagccgccgccg
ccgtcccatgccaacccggacctgccgccgcccttcgacggcctgatcctgaaggcgctg
gccaagacgccgggcgaccgctttgccagcgccggggagttcgccgacgcgctgcgccgc
gcgctggccgtcgccggcaccatgcaggcgccggcccccagcgccgagctcaccctgttc
ggcaccgagctgccggacatcgccccgccgctcgaccgcaacgccctgctggcggcgctg
gagacggcgctgcgcgccatccccggccaaccgatcgacgcgcgcaggctggaagagctg
ctgggcatgctggcggactggcaggccggcggcgaacaggcgacctcggccggcgagttg
cagcgctggcagtcgctgctgctcggagccgggatcgagcccctgaccgagctgatcgtg
gcggccgcccccgccccgcgcgccgccccggcgagccagcggcgcgactggatgccgctg
gtccggctgttcgccgcgctgaaccgcgcgctggccggcacgccggcggccgaccgggcc
aggatgtcggcggcgcgcatcgccttcgacctgtccggccgcttcttcctctattccggc
gagctgaaccgggtgctgatggacggcgacaatccggacatccagatgctgtcgctcgac
ttcctgcggctggagctgcttcagcatgcgctggaggagctgggggccgaggccgagctg
gcgcagagccgcagcgccatgctgatgttcgccgtccaggtcatccgcaaggtgacgcag
atcctgcgcgcctgcaccgacggcaacgacgggctggcccgcttcggcgtcgccatcatc
ctcgccaacatcgaggagctgatcgtgatggcccagcgcctgttcgagaccggcgggcag
gccaccggcgggctgccgcaggacgcggtggccgagttcatcgccgccgccggccggttc
gccagcctgtcggtggaagagctgcgcggcgaggtcgcccagggaaacctggctggggga
aacatggcgggcagcgccgacagcttcgccgcccgcctgcgcggtgtcggccagctctat
ctgttcgccacgcggctcaccgcgccggactgcgcgccgatgatgcacagcctgtcgacc
atgctctacggactggtcgccgggctgacggccgatctcggcaacgccccggtgtccgac
acaggcgcccgcgcccggctggtggcgttggccgacatggcaagcgggctcggctggagc
gaggtcgaacggatcgccctgacggccttgcgccgctgggcggtggcgggcgtgacggcg
tga

DBGET integrated database retrieval system