KEGG   Azospirillum thiophilum: AL072_11145Help
Entry
AL072_11145       CDS       T04091                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ati  Azospirillum thiophilum
Pathway
ati00330  Arginine and proline metabolism
ati01100  Metabolic pathways
ati01110  Biosynthesis of secondary metabolites
ati01130  Biosynthesis of antibiotics
ati01230  Biosynthesis of amino acids
Module
ati_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AL072_11145
Enzymes [BR:ati01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AL072_11145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NMT1_2 ApbA
Motif
Other DBs
NCBI-ProteinID: ALG71373
UniProt: A0A0F2KZ84
LinkDB All DBs
Position
1:2418521..2419345
Genome map
AA seq 274 aa AA seqDB search
MTGETGAALLLVGCGKMGGAMLDGWLTAGTASRVVVVDRAGLPASVSGDARVALAAGADG
LPDGFVPDVVVLAVKPQVMEEALPAYRALVRPGTVFLSIAAGKTIAYFERLLGEGAVVVR
SMPNTPAAIGRGMTVAVANSRVSEAQRALSDRLLRAVGDVAWVEDEGLLDPVTALSGSGP
AYVFFLVEAMARAGEAAGLPADLALRLARATVSGSGALLDASPQQEPADLRKAVTSPNGT
TQAALEVLMAPDGLQPVLTAAIAAAARRSRELAG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgagacgggtgcggcgctgctgctggtcggttgcgggaagatgggcggggcg
atgctggacggctggctgaccgccgggaccgcgtcgcgcgtcgtggtggtcgaccgggcc
ggcctgccggcctcggtgtccggcgatgcgcgggtcgcgctcgccgccggtgcggacggc
ctgccggacggcttcgtccccgacgtcgtcgtgctggcagtcaagccgcaggtgatggag
gaggcgctgccggcctaccgtgcgctggtccgccccggcaccgtcttcctgtcgatcgcc
gccggcaagaccatcgcctatttcgagcggctcctgggcgagggggcggtcgtcgtccgc
tccatgcccaacaccccggccgccatcggccgcggcatgaccgtcgccgtcgccaattcc
cgcgtcagcgaagcccagcgcgcgctgtcggaccggctgttgcgcgcggtcggcgacgtc
gcctgggtcgaggacgaggggctgctcgatcccgtcaccgcgctgtcgggcagtggcccg
gcctatgtcttcttcctggtcgaggcgatggccagggccggcgaggccgccgggctgccg
gccgatctggcgctgcggctggcccgcgccaccgtgtcggggtccggcgccctgctcgac
gcctcgccgcagcaggagcctgcggatctgcgcaaggcggtgaccagcccgaacggcacc
acccaggcggcgctggaggtgctgatggcgccggacggcctgcagccggtgctgaccgcc
gccatcgccgccgccgcccggcggtcgcgcgaactggccggctga

DBGET integrated database retrieval system