KEGG   Azospirillum thiophilum: AL072_20940Help
Entry
AL072_20940       CDS       T04091                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ati  Azospirillum thiophilum
Pathway
ati00970  Aminoacyl-tRNA biosynthesis
ati01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ati00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AL072_20940 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ati03029]
    AL072_20940 (gatB)
Enzymes [BR:ati01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AL072_20940 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AL072_20940 (gatB)
Mitochondrial biogenesis [BR:ati03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AL072_20940 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ALG73482
UniProt: A0A0F2KQ88
LinkDB All DBs
Position
3:complement(379223..380674)
Genome map
AA seq 483 aa AA seqDB search
MSYIQGETGDWEIVIGLEVHAQVISNAKLFSGSATEFGAAPNSQVSFVDAAFPGMLPVIN
EFCVEQAVRTGLGLKAQINLTSVFDRKNYFYADLPQGYQISQFLQPIVGKGEIVLDLPDG
TSRTVGVTRLHLEQDAGKSLHDQHPSKTFIDLNRSGVALMEIVSEPDMRTSEEAGAYVRK
LRSILRYLGTCDGNMEEGSMRCDVNVSVRKPGDEFGTRCEIKNVNSIRFVMAAIEYEARR
QIEIIEDGGKINQETRLWDTTKFVTRSMRSKEEAHDYRYFPDPDLLPLELDEAWVQEIEK
TLPELPDDKKARFIDDYKLSVYDAGVLVSEKAKADYFEAVAKGRDPKLASNWVTGELFGY
LNKAGKEIEESPVSAGNLGGLIDLIADNTISGRIAKEVFETMFETGGTAADIVEQKGLRQ
VTDTGAIEGAIDAVLAANPDKVAEFRSGKDKLFGFFVGQVMKATQGKANPAMVNEILTKK
LKG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacatccagggtgaaacgggcgattgggaaatcgtgatcgggctcgaggtccat
gcccaggtgatttcgaacgcgaagctgttctccggctccgccaccgaattcggggcggcg
ccgaacagccaggtcagcttcgtcgacgctgcgttccccggcatgctgcccgtcatcaac
gaattttgcgtcgagcaggcggtgcgcaccggcctgggcctgaaggcgcagatcaacctg
acctcggtcttcgaccgcaagaactacttctacgccgatctgccgcagggctatcagatc
agccagttcctgcagccgatcgtcggcaagggcgagatcgtgctcgatctgccggacggc
accagccgcaccgtcggcgtcacgcgcctgcatctggagcaggacgcgggcaagtcgctg
cacgaccagcacccgtccaagaccttcatcgacctgaaccggtcgggcgtggcgctgatg
gagatcgtgtcggaacccgacatgcgcacgtcggaggaggccggcgcctacgtgcgcaag
ctgcgctcgatcctgcgctatctcggcacctgcgacggcaacatggaggaaggctccatg
cgctgcgacgtcaacgtgtcggtgcgcaagccgggcgacgaattcggcacccgctgcgag
atcaagaacgtcaactcgatccgcttcgtcatggccgccatcgagtacgaggcgcgccgc
cagatcgagatcatcgaggatggcggcaaaatcaaccaggaaacccgcctgtgggacacg
accaagttcgtgacccgctcgatgcggtcgaaggaggaggcgcacgactaccgctacttc
cccgaccccgacctgctgccgctcgaactcgacgaggcgtgggtgcaggagatcgagaag
acgttgccggaactgccggacgacaagaaggcccgcttcatcgacgactacaagctgtcg
gtctatgacgccggcgtgctggtgtcggaaaaggccaaggccgattatttcgaggcggtg
gccaagggccgcgatcccaagctggcgtccaactgggtcaccggcgagttgtttggctac
ctcaacaaggccggcaaggagatcgaggagagcccggtgtccgccggcaacctcggcggc
ctgatcgacctgatcgccgacaacaccatctccggccgcatcgccaaggaggtgttcgag
acgatgttcgagaccggcgggacggccgccgacatcgtcgagcagaagggtctgcgccag
gtcaccgacaccggcgccatcgagggcgcgatcgacgccgtgctggccgccaaccccgac
aaggtggctgagttccgcagcggcaaggacaagctgttcggcttcttcgtcggccaggtg
atgaaggcgacccagggcaaggccaacccggccatggtcaacgaaatcctgaccaagaaa
ctgaaggggtaa

DBGET integrated database retrieval system