KEGG   Azospirillum thiophilum: AL072_21275Help
Entry
AL072_21275       CDS       T04091                                 

Definition
(GenBank) hypothetical protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
ati  Azospirillum thiophilum
Pathway
ati02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ati00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL072_21275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ati02000]
    AL072_21275
Transporters [BR:ati02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    AL072_21275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_16 AAA_22 AAA_23 AAA_33 Zeta_toxin APS_kinase AAA_5 MMR_HSR1 AAA_18 NB-ARC AAA_15 ATP-synt_ab MeaB AAA_30 DUF2075 NACHT
Motif
Other DBs
NCBI-ProteinID: ALG73857
UniProt: A0A0F2KUL9
LinkDB All DBs
Position
3:454162..456267
Genome map
AA seq 701 aa AA seqDB search
MPPVTLPEPAPLLDVRGLTISYGNARGTLRAASDVSFAIRPGEVMGLVGESGSGKSTIAM
AILDLLGGGGRVESGEILFDGTDLRKLPPSGRRALRGDRIAAVFQDPFTSLNPALTVGRQ
IAEPLIQHKGFSPRQAAVRVEELLAEVGIRDPRRVAAAYPHELSGGMQQRALIATALGCE
PKLLILDEPTTALDVTVEARIIELLAKLCDSHKLSALFVSHNLGIVNRICETVTVLYGGV
VVETGRTGRVLSRPAHPYAKGLVAALPRITADRRHRLPSIPGTVAKLTGAPAACVFAPRC
PFAEETCRSQPQAMLTNGDGSEDGVRCWKAGALAGTPWPDEEAGVSRRPTARTPTATHSA
PLVEVDHLRKIYGASRSILPWLRRAGTVAVDDVSFTIGRGEVVGVVGESGSGKSTIGRAL
LALTEPTAGAVLFDGADLTEQVKSGNQDLRRRAQLVFQNSAASLNPRKTVGAAMDRPLVL
AGREDAEERRKTVAGLLTRVGLPAAYADRYPHELSGGERQRVNIARALATDPDFVVCDEA
VSALDVSVQANILNLLAELRDEMGLSYLFITHDIAVVSHIADRVLVVYGGTICEEGPIGR
VLRPPYHPYTEALLSAVPRLAGDGPEAPRILLEDAVAAPGGRGCAFAARCPRKLGAVCDE
QSPPVHETADGHRIACHIPLATLAERAAVFPELAGADATPG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atccccccggtcaccctgcccgaaccggcgccgctgctggatgtgcgcggcctgaccatc
agctacggcaacgcccgcggcacgctgcgcgccgccagcgacgtcagcttcgccatccgc
cccggcgaggtgatggggctggtcggcgaatccggatcgggcaagagcaccatcgccatg
gcgatcctcgatctgctgggcggcggcggtcgggtcgagtccggggagatcctgttcgac
ggcaccgacctgcgcaagctgccgccgtccgggcggcgggcgctgcgcggcgaccgcatc
gccgccgtgttccaggatcccttcacctcgctgaacccggcgctgaccgtcggccgccag
atcgccgagccgctgatccagcacaaggggttctccccgcggcaggccgccgtccgggtc
gaggagttgctggccgaggtcggcatccgcgatccccgccgcgtcgccgccgcctacccg
cacgagctgtcgggcggcatgcagcagcgggcgctgatcgccacagcgctgggctgcgag
ccgaagctgctgatcctcgacgagccgaccaccgcgctggacgtgacggtcgaggcccgc
atcatcgagctgctggccaagctgtgcgacagccacaagctgagcgcgctgttcgtctcg
cacaatctcggcatcgtcaaccgcatctgcgaaaccgtcaccgtcctctatggcggggtg
gtggtggagacggggcggaccggccgcgtgctgtcccgcccggcccatccctatgccaag
gggctggtcgccgccctgccgcgcatcaccgccgaccggcgccaccggctgccctccatc
cccggcaccgtggccaagctgaccggggcgcccgccgcctgcgtcttcgccccgcgctgc
cccttcgccgaggagacctgccgcagccagccgcaggcgatgctgacgaatggcgacggc
agcgaggatggcgtgcgctgctggaaggccggcgccctggccggcacgccctggccggac
gaggaggccggggtatcccgccggcccacggcaaggacgccgacggcgacgcactccgcc
ccgctggtcgaggtcgaccatctgcgcaagatctacggcgccagccgctccatcctgccc
tggctgcgccgggccggcaccgtggcggtggacgacgtgtccttcaccatcggccgcggc
gaggtcgtcggcgtggtcggcgagagcggcagcggcaagagcaccatcggccgcgccctg
ctggcgctgaccgaacccacggccggagccgtgctgttcgacggcgccgacctcacggag
caggtgaaaagcggcaaccaggatctgcgccgccgggcccagctggtcttccagaattcg
gccgcctcgctgaacccgcgcaagaccgtgggggcggcgatggaccggccgctggtgctg
gccggccgcgaagatgcggaggagcggcggaagaccgtcgccggcctgctgacccgcgtc
gggctgccggcggcctatgccgaccgctacccgcacgagctgagcggcggcgagcgccag
cgcgtcaacatcgcccgcgcgctcgccaccgatcccgacttcgtcgtctgcgacgaggcg
gtgtcggcgctcgacgtgtcggtgcaggccaacatcctgaacctgctggccgagctgcgc
gacgagatgggattgtcctatctcttcatcacccatgacatcgccgtggtgtcgcacatc
gccgaccgcgtgctggtcgtctatggcggcaccatctgcgaggaggggccgatcggccgc
gtgctccgcccgccctaccacccctataccgaggcactgctgtccgccgtgccgcggctg
gccggggacgggccggaggcgccgcgcatcctgctggaggatgccgtcgccgcccccggc
gggcggggatgcgccttcgccgcccgctgcccgcgcaagctgggggcggtctgcgacgag
cagtccccgccggtccatgagacggccgacggccaccgcatcgcctgccacatcccgctg
gcgacgctggccgaacgcgccgcggtctttccggagcttgccggcgcggacgccacgccc
ggctga

DBGET integrated database retrieval system