KEGG   Anaerolinea thermophila: ANT_01840Help
Entry
ANT_01840         CDS       T01410                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00030  Pentose phosphate pathway
atm00051  Fructose and mannose metabolism
atm00052  Galactose metabolism
atm00680  Methane metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01130  Biosynthesis of antibiotics
atm01200  Carbon metabolism
atm01230  Biosynthesis of amino acids
atm03018  RNA degradation
Module
atm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_01840 (pfkA)
   00030 Pentose phosphate pathway
    ANT_01840 (pfkA)
   00051 Fructose and mannose metabolism
    ANT_01840 (pfkA)
   00052 Galactose metabolism
    ANT_01840 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    ANT_01840 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ANT_01840 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:atm01009]
    ANT_01840 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:atm03019]
    ANT_01840 (pfkA)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ANT_01840 (pfkA)
Protein phosphatases and associated proteins [BR:atm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ANT_01840 (pfkA)
Messenger RNA biogenesis [BR:atm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ANT_01840 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat AIRC PucR Metallophos_2
Motif
Other DBs
NCBI-ProteinID: BAJ62218
NITE: ANT_01840
UniProt: E8MZ75
LinkDB All DBs
Position
216965..217951
Genome map
AA seq 328 aa AA seqDB search
MIMFKTSLRTIGVMTSGGDAPGMNPAIRAVVRTALANGIRVIGIEDGYEGMLNGRFREMG
ARDVGGILQRGGTILRTARSMEFKTPEGQRKAIRQLSSAGIDAVVIIGGDGSLTGGMKLQ
EQGVPVIGIPGSIDNDIYGTDMCVGVDTALNTIVDAIDKLRDTASSHNRAFFVETMGRNC
GYLAVQAGIICGAEMAIIPEYETPFKEVAEAVEDAYKRGKSHCIIVVAEGAKLNANELAA
KLQEMNVGFDTRVTVLGHVQRGGKPTAFDRFLATRFGVKAIEFLLSGQTGVMTALTGRDI
TPIPLATVVNNRRTLSEEYIKMARILAR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgattatgttcaagacttcactcagaaccattggtgtgatgacttcggggggggatgct
cccggaatgaatcctgccatccgcgcggtggtgcgcacggcactggcaaacggcatccgg
gtgattggcattgaagacggctatgaaggcatgctcaacgggcgtttccgcgagatgggc
gcgcgcgatgtcggcggcattttacagcgcggggggacgattctgcgcactgcccgcagt
atggaattcaaaactccggaaggacagcgcaaagccattcgccagttgagcagcgctggc
attgatgcggtggtcatcatcggcggagatggctcattgaccggtgggatgaaactgcag
gaacagggcgtgccggtgattggcatccccggcagtattgataacgacatctacggcacc
gatatgtgcgtcggcgtggataccgccctcaacaccattgtggacgccattgacaaactg
cgcgatacggcatcctcacacaaccgcgccttcttcgttgagaccatggggcgtaactgc
ggctatctggcggtgcaggcaggcatcatctgcggggcagagatggccattatccccgag
tacgaaacccccttcaaagaagtggctgaggcagtggaagatgcctacaagcgcggtaag
tcgcactgcatcattgtggtggcggaaggcgccaaactcaacgccaacgaactggcggca
aaactgcaggaaatgaacgtgggctttgatacccgcgtgaccgtgctggggcatgttcag
cgcggcggaaaacccactgccttcgaccgcttcctggcaacccgctttggcgtcaaagcc
attgagttcctgcttagcgggcaaaccggcgtgatgaccgccctgaccgggcgcgacatc
acccccatcccgctggcgacggtggtcaacaaccgccgtaccctgagtgaggaatacatc
aagatggcgcgcatcctggcgcggtaa

DBGET integrated database retrieval system