KEGG   Anaerolinea thermophila: ANT_03170Help
Entry
ANT_03170         CDS       T01410                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
atm  Anaerolinea thermophila
Pathway
atm00970  Aminoacyl-tRNA biosynthesis
atm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ANT_03170 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:atm03029]
    ANT_03170 (gatA)
Enzymes [BR:atm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ANT_03170 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ANT_03170 (gatA)
Mitochondrial biogenesis [BR:atm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ANT_03170 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAJ62351
NITE: ANT_03170
UniProt: E8N016
LinkDB All DBs
Position
complement(344817..346307)
Genome map
AA seq 496 aa AA seqDB search
MSRIPDLSVSELLAGMRRGDFSAVEVTRAFLEVIERLEPSLHTLITFTPELALRMAEDAD
RRYRAWRRADSPAEEALPPLLGIPLMVKDVLCLKGVPCTCGSRILQDFIPPYTATAVQRL
LDAGVVVLGKTNTDEFAMGSSTENSAFGATRNPWNPAHVPGGSSGGSASAVAARMTPAAL
GSDTGGSIRQPAAYCGVTGIKPTYGRVSRYGLVAYGSSLDTVGVFARSAAETALFFSLMA
GHDPLDSTSAREAVSPITLPDEPALKGLRIGVPQEYFIPGMSAEVEQAVRAAIAQLEHLG
ATVQMVRLPHTEYALPVYYLIAPAEASANLARYDGVRFGLRAPAERLWEMFDRTRGSGFG
AEVKRRIMLGTYALSAGYYDAYYAQAQKVRTLIRQDFLDAFQQVDVIACPVAPTPAFRLG
EHTDDPLAMYLEDIFTLPANLAGVPGLAFPAGFSAAGLPIGIQLMSAPFREEILFQTAHA
YQQVTDWHLRRPPTAP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattcccgatctttcggtctccgaactgctggcgggcatgcgccgcggcgat
ttctccgccgtggaagtgacccgcgcctttctcgaggtcatcgagcgcctcgagccgagc
ctgcacaccctcatcaccttcacccccgaactggcattgcgcatggcggaagacgccgac
cgccgctaccgcgcatggcgccgcgcagattcccccgccgaagaggctctgccccctctg
ctgggcatccccctgatggtgaaagatgtgctgtgcctgaagggcgtaccctgcacctgc
ggctctcgcatcctgcaggacttcatcccgccctacacggcaaccgccgtccagcgtctg
ctggatgccggcgtggtggtgctgggcaaaaccaacaccgatgaatttgccatgggctct
tccaccgaaaactccgcctttggcgctacccgcaacccctggaatcccgcgcacgtaccc
ggcggctcatccggcgggagcgccagcgccgttgccgcgcgcatgacccccgccgcgctg
ggctcggatacgggcgggagcatccgtcagcccgcggcttactgcggtgtgaccggcatc
aaacccacctacgggcgcgtgtcgcgctacgggctggtggcttatggttcatcgctggac
acggtaggcgtgtttgcccgcagtgccgccgagacggcgctgttcttctcgctcatggca
ggacacgatccgctggattcgacctcagcgcgcgaagcggtctcacccatcaccctgccg
gatgaacccgcgctgaagggactgcgcattggcgtgccgcaggagtacttcatccccggc
atgtcggcagaggtagaacaagccgtgcgcgccgccattgcccaactggagcatttaggc
gcaaccgtgcagatggtgcgcctgccccataccgaatacgccctgccggtgtattacctc
attgcccctgccgaagcctctgccaatctggcgcgctacgacggcgtgcgctttggcttg
cgcgcccccgccgaacgcctgtgggagatgttcgaccgcacccgcgggagcggctttggc
gctgaagtgaaacgccgcatcatgctgggcacttatgcgctctccgccgggtattacgat
gcctactacgcgcaggcgcagaaggtgcgcaccctcatccgccaggattttctggacgcc
ttccagcaggtggatgtcatcgcctgcccggttgcgcccacccccgccttccgccttggc
gagcataccgacgaccctctcgccatgtacctggaagatatcttcaccctgcccgccaac
cttgccggtgtgccaggcttggcgttccccgcaggcttcagcgcggcgggactgcccatc
ggcatccaactgatgagcgcccccttccgcgaggaaatcctcttccagacggcgcacgcc
taccagcaggtaaccgactggcatctgcgccgtccccccactgccccctaa

DBGET integrated database retrieval system