KEGG   Acetobacter tropicalis: CIW82_02300Help
Entry
CIW82_02300       CDS       T05181                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ato  Acetobacter tropicalis
Pathway
ato00250  Alanine, aspartate and glutamate metabolism
ato00280  Valine, leucine and isoleucine degradation
ato00410  beta-Alanine metabolism
ato00640  Propanoate metabolism
ato00650  Butanoate metabolism
ato01100  Metabolic pathways
ato01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ato00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CIW82_02300 (gabT)
   00650 Butanoate metabolism
    CIW82_02300 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIW82_02300 (gabT)
   00280 Valine, leucine and isoleucine degradation
    CIW82_02300 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CIW82_02300 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ato01007]
    CIW82_02300 (gabT)
Enzymes [BR:ato01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CIW82_02300 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CIW82_02300 (gabT)
Amino acid related enzymes [BR:ato01007]
 Aminotransferase (transaminase)
  Class III
   CIW82_02300 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATJ89701
UniProt: A0A291PEA2
LinkDB All DBs
Position
506296..507576
Genome map
AA seq 426 aa AA seqDB search
MSTTNKDLLTRRANAVPRGVATATPVFADRAENAELWDVEGRRYIDFAGGIAVLNVGHRH
PKVLAAAKAQLERFTHTAFQVSAYESYIELAEKLNALAPFSGPAKTIFFSTGGEATENAV
KIARAATGRNGVIAFCGGFHGRTLLASAMTGKVLPYKAPFGTLPGQVYHLPFPDGDVTVE
DSLKMLHFLFASDIGPEQVAAIIIEPVQGEGGFRIAPPALLKHLRSLCDEHGIKLIADEV
QTGFARTGKMFGIEHSGVEPDLVSVAKSLGGGFPISGVIGRADLMDSVPPGGLGGTYAGA
PLACAAALAVLDVIEEEKLIDRANTMGERLKARINGWHKRKDILPVSTARGLGAMIAFDI
LENHAGEEQRAGFASKVCAKACEKGLILLSCGVKGATIRILTPLTASDALVDEGLDVIEQ
VLVELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccaacaaggaccttctcacccgccgcgccaatgccgtgccacgtggtgtt
gccacagctacacctgtgtttgcagatcgcgctgaaaacgctgaactgtgggatgtggaa
ggtcgccgctacattgatttcgcaggcggaattgcggtgctgaatgtgggccatcgtcat
cccaaggtattggctgctgccaaagctcagctagagcgtttcactcacacggcgtttcag
gtttcagcctacgaatcctatatcgaactggccgaaaaactgaacgcccttgcgcctttt
tctggcccggccaagaccattttcttctccaccggcggggaagcgacggaaaatgccgtt
aaaattgcgcgcgccgccaccggccgcaacggggtgattgcgttctgtggcgggttccat
ggccgcacgctgctggcctctgccatgacgggcaaggttctgccctacaaagcaccgttt
ggcaccttgccgggacaggtttatcacctccccttccctgatggagacgtaacagtagaa
gacagcctgaaaatgctgcacttcctgtttgcgtcagacattgggccggagcaggttgcc
gccattattattgaacccgtgcagggtgaaggtggcttccgcatcgcgccgcctgccctg
ctgaagcatcttcgcagcctctgcgatgaacacggcatcaagctgattgcggatgaagtg
cagaccggttttgcccgcaccggcaaaatgtttggcattgagcactccggcgttgagcct
gatctggtgtctgtcgccaagtctctgggcggtggctttcccatttccggtgtgattgga
cgggcagacctgatggattccgtgccgccggggggcctgggcggcacctatgccggggca
ccgctggcctgtgccgcagcgctggccgtgctggatgttattgaagaagaaaagctgatt
gaccgtgcaaacaccatgggcgaacgcctgaaggcacgaatcaatggctggcacaaacgc
aaggatattctccctgtcagtaccgcacgtgggctaggtgccatgattgcgtttgatatt
cttgaaaaccacgctggagaagaacagcgcgcaggctttgccagcaaagtctgtgccaaa
gcctgtgaaaaagggctgatcctgctctcctgtggtgtaaagggcgccaccattcgtatt
ctcaccccgctcaccgcttccgatgcgctggtggacgaagggctggatgtgattgaacag
gttctggttgaactggcctga

DBGET integrated database retrieval system