KEGG   Acetobacter tropicalis: CIW82_05900Help
Entry
CIW82_05900       CDS       T05181                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ato  Acetobacter tropicalis
Pathway
ato00473  D-Alanine metabolism
ato01100  Metabolic pathways
ato01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ato00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CIW82_05900 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CIW82_05900 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ato01011]
    CIW82_05900 (alr)
Enzymes [BR:ato01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CIW82_05900 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ato01011]
 Precursor biosynthesis
  Racemase
   CIW82_05900 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATJ90290
UniProt: A0A291PFN3
LinkDB All DBs
Position
1302030..1303163
Genome map
AA seq 377 aa AA seqDB search
MSSCSLPRADWAATRAGAVLTVDLGAIVDNYRQLVQRTAGAVCAAVVKADAYGLGAAHVA
PALQKAGAKEFFVAHVDEGLALRPSLSPHARITVLHGARPDALAECVESGLRPVLNSMEQ
IAQLRTLAERKGKALDAVLQLDTGMSRFGLSASDVQQLFENPALLRGISLSLIMSHLACA
DTPENPANAQQLERLKQYAAQLPPAPLSLAASSGIFLGAAYHQDLVRPGAALYGVAPNAS
GPNPLKQVVRLQARVLQTRTLSKGDRVGYGLTWQAEGPCRVATLATGYADGFARQGASMG
CAWFKGQKLPILGRISMDSMTVDVSAIPEAELAADALVDLLNAQYGVDDVAAAEGTIGYE
VLTSLGRRYHRVYQHHA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctgttctcttccgcgtgctgactgggctgctacccgggcaggtgccgtgttg
acggtggatctgggagccatagtggacaattatcgccagcttgttcagcgcactgccggt
gcggtgtgtgctgcggtggtcaaagcggatgcctatgggcttggcgcggcgcatgtggcg
cctgctttgcaaaaggctggcgcaaaagagttttttgttgcgcatgtagatgaaggcctg
gctctaagaccctccctttcgccacacgcgcgaattaccgttctacacggggcccggccg
gacgccttggcggaatgtgtggaaagcgggctgcggcccgtgctcaacagcatggaacag
attgcgcagttacgcacactggctgagcggaagggcaaggcgcttgatgctgtcttgcag
ttggacacaggcatgtcccgtttcggtctttctgcaagcgatgttcagcagctttttgaa
aaccctgctctgctgagagggatatctctcagcctgatcatgagccatcttgcctgtgcg
gatacgccggagaacccggctaatgcccagcagttggagcggttgaaacagtatgccgcc
cagttgcctccggcaccgctcagcctcgcggcatcatccggtatttttctgggtgctgcg
tatcatcaggatctggtgcgccctggtgcagcactttatggcgtggcccccaatgcctct
ggccccaaccctctgaagcaggtggtgcgtttgcaggcgcgtgtgctgcaaacccgcacg
ctctcaaaaggagacagggtgggatacgggctgacatggcaggccgaggggccatgccgg
gtggcgacccttgccacaggatacgcggatggttttgcccgtcagggcgccagcatgggc
tgtgcgtggttcaaggggcagaaattgcccattctgggccggatttccatggattccatg
acggtggatgtctctgccattcccgaggcggaactggcggctgatgcactggtggatctg
ctgaatgcacaatatggcgtggatgatgttgccgctgcggaagggaccatcggctatgag
gttctaacgtctctggggcggcggtatcaccgcgtttaccagcatcacgcgtga

DBGET integrated database retrieval system