KEGG   Acetobacter tropicalis: CIW82_11320Help
Entry
CIW82_11320       CDS       T05181                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ato  Acetobacter tropicalis
Brite
Translation factors [BR:ato03012]
 Eukaryotic Type
  Elongation factors
   CIW82_11320 (tuf)
 Prokaryotic Type
   CIW82_11320 (tuf)
Mitochondrial biogenesis [BR:ato03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CIW82_11320 (tuf)
Exosome [BR:ato04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CIW82_11320 (tuf)
  Exosomal proteins of breast cancer cells
   CIW82_11320 (tuf)
  Exosomal proteins of colorectal cancer cells
   CIW82_11320 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ATJ91187
UniProt: A0A291PIH2
LinkDB All DBs
Position
2456767..2457957
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKTLAKSGGADFKAYDQIDAAPEERARG
ITISTAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDEIPIIKGSALVTLE
DGDPEVGENRVKDLMDAVDEYIPQPERPIDRPFLMPIEDVFSISGRGTVVTGRVERGAVN
VGDEVEIVGLKDTVKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHKKFKAKAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNCA
MDVELIAPIAMDEGLRFAIREGGRTVGAGVVASITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaaatttgagcggaataaaccgcactgcaacatcggcaccatcggccac
gttgaccatggcaagacgtctctgacggctgctatcacgaagacgctggcaaaaagcggc
ggtgctgacttcaaggcatacgaccagatcgatgctgctcctgaagaacgcgctcgtggc
atcaccatttccacggctcacgtggaatacgaaaccgcgaagcgtcactacgctcacgtg
gactgccccggacacgccgactatgtgaagaacatgatcacgggtgccgctcagatggac
ggcgcgatcctggttgtgtccgctgctgacggcccgatgccgcagacccgtgaacacatc
ctgcttgctcgtcaggttggtgtgccggctctggttgtcttcctgaacaaggttgaccag
gttgacgatccggaactgcttgaactggttgaaatggaagttcgtgaacttctgtcttct
tatcagttcccgggtgacgaaattccgatcatcaaaggttctgctctggtgacgctggaa
gatggcgatccggaagttggcgaaaaccgcgtcaaagacctgatggacgctgttgacgaa
tacatcccgcagccggaacgtccgatcgaccgtccgttcctgatgccgatcgaagacgtg
ttctccatctctggtcgtgggaccgtggtgacgggccgtgtcgaacgtggcgctgtgaac
gttggtgacgaagttgaaatcgttggcctgaaagacaccgtcaagacgaccgttaccggt
gttgaaatgttccgcaagctgcttgatcgcggtgaagctggtgacaacattggtgcgctg
ctgcgtggcacgaagcgtgaagatgttgaacgtggtcaggttctggccaagccgggctcc
atcaccccgcacaagaagttcaaggcaaaagcctacatcctgacgaaggaagaaggtggc
cgtcatacgccgttcttcaccaactatcgtccgcagttctacttccgtacgactgacgtg
acgggtgttgtgcacctgccggaaggcacggaaatggtcatgcctggcgataactgcgcc
atggatgttgaactgattgcaccgatcgccatggatgaaggtctgcgcttcgctatccgc
gaaggtggccgcaccgttggtgcaggtgttgtggcttccatcaccgagtaa

DBGET integrated database retrieval system