KEGG   Acetobacter tropicalis: CIW82_12635Help
Entry
CIW82_12635       CDS       T05181                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ato  Acetobacter tropicalis
Pathway
ato00061  Fatty acid biosynthesis
ato00780  Biotin metabolism
ato01100  Metabolic pathways
ato01130  Biosynthesis of antibiotics
ato01212  Fatty acid metabolism
Module
ato_M00083  Fatty acid biosynthesis, elongation
ato_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ato00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CIW82_12635
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CIW82_12635
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CIW82_12635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ato01004]
    CIW82_12635
Enzymes [BR:ato01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CIW82_12635
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CIW82_12635
Lipid biosynthesis proteins [BR:ato01004]
 Fatty acid synthase
  Component type
   CIW82_12635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ATJ91405
UniProt: A0A291PJ25
LinkDB All DBs
Position
2745158..2745997
Genome map
AA seq 279 aa AA seqDB search
MSSHDTTLPAKGTLMQGKKGLVMGVANDRSIAWGIASAVAAQGGEMAFTYQGEALGKRVT
PLAQSIGASLVLPCDVTDDAAIDAVFTKLEQEWGELDFVVHAIGWADKKYLRGRYVDTPR
DAFLTALDISCYSFTAVAQRAARLMKNGGSLLTLSYLGAERVMPHYNVMGVAKAALEASV
RYMAADLGKDAIRVNAISAGPIKTLAASGIGDFRYILKWNQYNAPLERNVALEEVGGAGL
YMLSDLSSGVTGEVHHVDSGYHMVGMKNPTAPDISVAGD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcatgacaccacattgcccgcaaagggtacgctgatgcagggtaaaaaaggg
ttggtcatgggggtggccaatgatcgttccatcgcatggggaattgccagcgcagtggcg
gctcagggcggggaaatggcctttacctatcagggcgaagctctgggcaagcgcgtgaca
cctctggcccaaagcattggcgcatccttggtgctgccatgcgatgtgactgatgatgca
gctattgatgccgtgttcactaagcttgaacaggaatggggtgagctggattttgtggtg
cacgccattggctgggctgataaaaaatatctgcgtggccggtatgtggacaccccgcgg
gatgcgtttctgacggcgctggatatctcctgctattccttcaccgccgttgcacagcgt
gcagcgcgtctgatgaaaaatggcggttctctgcttaccctgagctatctgggggccgag
cgtgtgatgccgcattacaacgtgatgggtgttgcaaaggcggctcttgaggcctccgtg
cgttatatggcggctgatctgggtaaggatgccattcgggtaaacgccatttctgctggc
ccgatcaagacccttgccgccagtggcattggtgatttccgttatatcctcaaatggaac
cagtataacgcaccgctggaacgtaatgtggctcttgaagaagtgggcggagctggcctc
tacatgctttcagacctttcttccggcgtgacgggtgaagttcatcatgtggatagtggc
taccacatggtgggcatgaaaaatccgaccgcacctgatatttccgtcgctggggactaa

DBGET integrated database retrieval system