KEGG   Amborella trichopoda: 18422276Help
Entry
18422276          CDS       T02990                                 

Definition
(RefSeq) alpha-amylase isozyme 3D
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
atr  Amborella trichopoda
Pathway
atr00500  Starch and sucrose metabolism
atr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    18422276
Enzymes [BR:atr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     18422276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 18422276
NCBI-ProteinID: XP_006826844
UniProt: W1NF33
LinkDB All DBs
Position
Unknown
AA seq 422 aa AA seqDB search
MSPLLFILLHLALALSNAAHAQLLFQGFNWQSWNNTEGWYRHLKGLVPQLVESSVTHVWL
PPPSQSAAREGYMPGRLYDLNASTYGTEADLRDLIKTLNANGIKAVADIVINHRTAETKD
SRGIWAVFEGGTPDDRLDWGPWAICKDDKEYSDGTGNLDTGVDFQPAPDMDHLNPRIQNE
LSEWLNWLKSSIGFEGWRLDFSRGYSGKLAGMYFDRSKPDFAVGEIWSGLVYGNDSKPQY
NQDKHRQELVDWVHETGDLGMAFDFTTKLLMNEALKDELWRLKDGNGKPIGLIGLLPEKA
VTFVDNHDTYSQNLAPTPRDKVMLAYAYIFTHPGIPSFFYDHYFEWGKKTEIVQMSAIRK
RNRIGPKSAVRILAADSDLYVAAIDEKIYMKIGSRYEVGDLVPSDFEVVMSGNDYAIWEK
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagccccctattattcatcctactccaccttgctcttgcgctctcaaatgctgctcat
gcacagctcctttttcagggttttaactggcagtcatggaataacacagagggatggtac
cgccatctgaaagggcttgtgcctcagcttgtggaatccagcgtcacacatgtctggctc
cctcctccctcacaatctgcagcccgagaaggatacatgcctggaaggctctatgacctt
aatgcttcgacgtatggaaccgaagccgatctgcgtgacctgatcaaaactctaaatgcc
aatggcatcaaggcggtcgctgacatcgtcatcaaccatcggacagcagagacgaaggac
tcccgtggcatctgggcagttttcgaaggtggcaccccagacgatcgcctcgactggggg
ccatgggccatctgcaaagatgacaaagagtactccgatggcactgggaacctagatacc
ggtgtcgattttcagcctgcacccgacatggaccacttgaatcccaggatccaaaatgag
ctatcagagtggctcaattggctcaagtctagtataggattcgagggttggcgccttgac
ttctcgagaggctattcgggcaagcttgccgggatgtacttcgatcgtagtaagcccgat
ttcgcagtgggtgaaatatggagtgggcttgtgtatggaaacgattcgaagccgcagtat
aatcaagataagcacaggcaggagcttgtggattgggttcatgagactggtgatttgggg
atggcctttgatttcacaactaaattgttgatgaatgaggctttgaaggatgagttgtgg
aggttgaaggacgggaatggaaagccaattggattgattgggcttttgcctgagaaggca
gttacttttgttgataaccatgatacctattctcagaacctggctcccacccctagagac
aaagttatgcttgcatacgcctacattttcactcatcctggaattccctcttttttttac
gaccattactttgagtggggcaagaagactgagattgttcaaatgagtgcgataaggaag
aggaaccgcatcgggccaaagagcgccgttcgcatcttggctgctgattcggacttgtat
gtggctgcgattgacgagaagatctatatgaagattggttcgaggtacgaagtgggtgac
ctcgttccctctgattttgaagtggttatgtcagggaacgactatgcaatatgggagaaa
aagaagtga

DBGET integrated database retrieval system