KEGG   Amborella trichopoda: 18426635Help
Entry
18426635          CDS       T02990                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
atr  Amborella trichopoda
Pathway
atr00071  Fatty acid degradation
atr00592  alpha-Linolenic acid metabolism
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
atr01212  Fatty acid metabolism
Module
atr_M00087  beta-Oxidation
atr_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    18426635
   00592 alpha-Linolenic acid metabolism
    18426635
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     18426635
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     18426635
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     18426635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO
Motif
Other DBs
NCBI-GeneID: 18426635
NCBI-ProteinID: XP_006833340
UniProt: W1NSF6
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MSLLMDVGADGVAVITISNPPVNSLATTIIAGLKEKYDEAIRRDDVKAIVLVGEGGKFSG
GFDINVMKRVQKTGDKSILPDVSVALLNDTVEAARKPSVAAIQGLALGGGLELAMACNAR
ISTPKAQLGLPELTLGVIPGFGGTQRLPRLVGLSKAIEMMLLSKPITSDEGRKLGLIDEI
VPADELLRVSRKWALDIAERRKPWLISLHLTDKLGSLSEARDTLKIARQQAARIAPNMPQ
HQVCLDAIEEGIVSGGYAGVVKEAKIFKESVVSDTAKGLIHAFFAQRTTSKITGVTDIGL
RPRPIKKVAVIGGGLMGSGIATALILSNTCVILKEANSNYLQQGIDRISANLKGLVAKGT
ISNDKFDKTMSLVKGALDYSEFSTVDMVIEAVIENVSLKQSLFNTFEKECPPHCILATNT
STIDLNLVGARTNSHDRIVGAHFFSPAHVMPLLEIVRSEKTSPQVILDLMTIGTAIKKVP
VVVGNCTGFAVNRNFFPYTQSAHLLVHLGVDLFRVDRVISSFGMPMGPFQLQDLAGYDLA
VAVSKEFASAFVGRTFTSPLVSIMMEKGRSGKKNGKGYYLYEKGSKPKADPNVLPIIEES
RRQVNILPGGKPIMVSDREILEMIFFPVVNEACRVLSEGIVVRASDLDISSVLGMGFPKY
RGGIVFWADSVGPTHIYSSLKKWAKAYGAFYEPCLFLEERAKKGIPLSDLVASSGGAMAR
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttttgatggatgtcggtgctgatggagttgcagtgatcacgatctccaatcca
cctgttaattcattggctactacaataattgctggattgaaggagaaatatgatgaggca
attcgaagagatgatgtcaaagccattgtccttgttggtgagggtggtaaattttctggt
ggattcgacataaatgtaatgaaacgggtccaaaagactggagataaatcaattctacca
gacgtctctgttgcacttctcaatgacactgttgaagctgctaggaagccctctgtagca
gctattcaaggtcttgcacttggcggtggcctggagttagcaatggcatgcaacgcaagg
atatccactccaaaagctcaacttggccttccagaactgacccttggagtaattcctggg
tttggaggtacacaacgccttccaagacttgtaggattgtcaaaggctatcgaaatgatg
ctgctatccaaaccgataacatctgatgagggtaggaaacttgggctgattgatgaaatt
gtaccagctgatgagttgttgagagtatcaaggaagtgggctttggatatcgctgagagg
cgcaaaccttggctaatctcccttcatctgactgataaacttggctctctttctgaagct
cgtgatacattgaaaattgctaggcagcaagcagcaagaattgctccaaatatgccacaa
caccaagtttgtcttgacgcgattgaagaaggaattgtatcaggaggatatgcaggcgtc
gtaaaagaagcaaaaattttcaaggagtcagttgtatctgatactgcaaaaggtcttatt
catgcattctttgctcaacggacaacttcaaagataactggtgtgactgatattggacta
agacccaggccaatcaagaaagttgcagttattggtgggggtttgatggggtctggcatt
gctacagctcttatcctaagcaatacttgtgtcattctcaaggaggccaattctaactat
ctgcaacaaggaattgacagaatttctgcaaatctaaagggtctagttgcaaaaggaact
atatcaaatgataagttcgacaagaccatgtcccttgtcaaaggtgccctggattactcg
gagtttagtacagtggatatggtcatcgaggctgtcattgaaaatgtttctttgaagcaa
tcactatttaatacgtttgaaaaggagtgtcctcctcattgtattttggcaacaaacaca
tctactattgatctcaatttggttggagcaaggacaaattcccacgatcgcatagtgggg
gcacacttcttcagccctgcacatgtgatgcccctgctagaaattgttcggtcagagaag
acttccccacaagtgattctcgatctcatgaccattggaacggccataaaaaaagtccct
gttgtagtaggaaactgcacaggattcgctgttaatcgaaacttcttcccttacactcaa
agcgcacatttgttggtacaccttggcgtcgatttgttcagagttgacagagtaatcagc
agttttggaatgccgatgggacctttccagctccaagatttggctggatatgatcttgca
gtagcagtatcaaaagagtttgcttcagcctttgtaggtcgcactttcacctctccatta
gtttcaatcatgatggaaaaggggcgatcagggaagaagaatgggaagggatactatctt
tatgagaaggggagtaaaccaaaagctgatcccaatgtgctacccatcattgaggagtct
aggagacaagtgaacatattgcctggaggaaagccaataatggtgagtgaccgtgaaatt
ttggagatgatcttttttccagttgtgaacgaggcttgccgggtgctgagtgaaggaatt
gttgttagagcatctgaccttgacatttcatctgttcttggaatgggtttccccaagtac
aggggagggattgtgttttgggcagattcagttgggcctacgcacatatattccagtctg
aagaagtgggctaaggcatatggtgccttttatgaaccatgcttatttttggaggaaagg
gctaagaaaggcattcctttgagtgatctggttgcatcaagtggtggtgcaatggcacgc
ctctga

DBGET integrated database retrieval system