KEGG   Amborella trichopoda: 18427275Help
Entry
18427275          CDS       T02990                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
atr  Amborella trichopoda
Pathway
atr00052  Galactose metabolism
atr00500  Starch and sucrose metabolism
atr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    18427275
   00500 Starch and sucrose metabolism
    18427275
Enzymes [BR:atr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     18427275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 VIR_N Rieske_2
Motif
Other DBs
NCBI-GeneID: 18427275
NCBI-ProteinID: XP_011620789
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MRRVEVGFSLSSFLLSLLFHIWCSSSSEPIGYGYTLKCINQSRDGKSMSGELSLINNSSV
YGPDVHNLILQVNFETPERLRVRITDADHARWEIPASIIPRPPPHSPEVIKLPPNYPSQI
PNLSPPDSDLEFTVLSNHPFAFTISRRSSNETLFNISPSEPNSRTGIVFKDQYLEISSQI
PTNAALYGLGEHTKDTLRLVPNDAFTMWNADIGTFNLNLNLYGSHPFYMDVRFPATGKDS
PMAHGVLLMNSNGMDVEYGGSFVKYRVVGGVLDFYFFAGPLPENVVQQYTELVGRPAPMP
YWSFGFHQCRYGYKNVSDLEGVVARYAKARIPLEVMWTDIDYMDAYKDFTLNPINFPANR
MRQFVDNLHKNGQKYIVIIDPGINVNDTYATYQRGNVADVWVKQGGKPYLAQVWPGPVYF
PDFFNPAASPYWQKEISEFHLTLPFDGLWIDMNEVSNFCSGTLCSLPPPGSLCPRPDAYT
ACCLVCSDENANALDKPPYDINNSGNNRPLGNKTLPASAMHHGNIPEYDAHNLYGLLESK
ATHDALANITNKRPFVLSRSTFIGSGTHTAHWTGDNAATWPDLARSVPAILSFGLFGVPM
VGADICGFNGNTNEELCNRWIQLGAFYPFSRDHSDINSIRQELYLWDSVTRSAREALGLR
YRLLPHFYTLMYEAHTKGTPIARPLFFSFPNDTTTYNISSQFMLGRGLMVSPVLTQGATS
VQAYFPVGTWFNLFDMKSAPITVTTGQQVVLNTPLEKTNVHLREGNVLVMQESRMTTEEV
RTSGFTIVVAVGTEEAKGELYIDDGKRMEMGGEGDGWSFVRFYGGFVGGGVVRVRSEVEK
GGFASGQGLVIKKVVFPGLGDGMNPKTLSLIVEGKGMDLNGAGASLNNGVAEINGLSLLI
GKEFDLRMNMEQKILIN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgagtggaggtcggcttttctctctcatctttcctactctctctcttatttcat
atttggtgttcttcttcttcagagcccatagggtatggctacacactcaaatgcataaat
cagagcagagatggcaaatcaatgtctggggaactctctctcatcaataattccagtgtc
tatggccctgatgttcacaatctcatcctccaagtcaactttgagaccccagaacgcctc
cgtgttcgcatcaccgatgccgaccatgcccgatgggagatcccggcctccatcatcccc
cgcccgcccccacactcacccgaggtcatcaaactccccccaaattacccctcgcaaatc
cccaatctctcccctccagactccgaccttgaattcaccgtcctctcaaaccaccccttt
gccttcaccatttctcgacgttcctctaacgaaaccctcttcaacatctcaccaagtgag
ccaaattccagaaccggtatagtattcaaagatcaatatctagagatctcctctcaaatt
cccacaaatgctgctctttatggcttaggagagcacaccaaggacactctaaggctagtc
ccaaatgatgcattcactatgtggaatgctgatatagggacctttaacctaaatttgaac
ctctatggatcacaccccttttacatggatgtcaggtttccagccacaggaaaagattct
ccaatggctcatggggtgttgttgatgaatagcaatgggatggatgtggagtatgggggg
agttttgtgaagtatagagtggtgggtggggttttggacttctacttttttgctggacct
ttgccagaaaatgtggtccagcaatacacagagctggttgggcgcccggcaccaatgcca
tattggtcttttggtttccaccaatgcaggtatggttacaagaatgtatcagatcttgaa
ggagtcgtggctagatatgcaaaggcaagaatacctcttgaagtaatgtggacagatata
gactacatggatgcctacaaagacttcactctcaatcccatcaatttcccagccaaccgg
atgaggcaattcgtagataatctccacaaaaacggccaaaaatacatcgttatcatagat
ccaggcatcaatgtaaacgacacatatgcgacctaccaacgaggcaatgtggcagacgtg
tgggtgaagcagggaggcaagccctaccttgcgcaagtgtggcccggccctgtttacttc
cccgacttcttcaaccctgccgcctccccatattggcaaaaagagatctctgagtttcac
ctcaccctcccatttgatggcctatggattgatatgaatgaggtctccaacttttgttca
ggcactctttgctccctacccccacccggatccctatgcccccgtcccgacgcttacact
gcgtgctgccttgtttgctccgatgaaaatgcaaatgcccttgacaagccaccttatgac
atcaacaactccgggaacaatcgcccccttggcaacaagaccctaccagctagtgcgatg
caccatggcaacatcccagaatacgatgcgcataacctatatggcctcttagaatcaaaa
gccactcatgacgccttggccaatataactaacaagcgccctttcgtgctctcaaggtcc
acattcattggctcgggcacccacaccgcacattggacaggtgacaatgcagccacgtgg
ccagacctagcacgctctgtgcctgcgatccttagctttgggttatttggggtgcctatg
gttggggccgacatatgtggctttaatggcaacacgaatgaggagctttgcaataggtgg
atccaactcggagccttctaccccttttcacgtgatcactctgacataaatagtattcga
caggagttatatttgtgggactctgttactcgatcagctcgtgaggccttgggcctcagg
taccgactccttccacatttttacacactcatgtatgaggctcacacaaaaggcacaccg
atcgctcgcccgctcttcttctccttccctaacgatactaccacatataatataagctcc
caatttatgcttggacgaggactaatggtctctcctgttctaacacagggggccacgtca
gttcaggcttactttccagtaggcacatggttcaacctcttcgacatgaaaagtgctcct
attacggtaacaacaggacagcaagtggtgttgaatacaccccttgagaagactaatgtg
cacttacgagaagggaatgtgcttgtgatgcaagagtcgaggatgactactgaagaagtc
cggactagtgggttcacaatagtggtggctgtagggactgaggaggcgaaaggagagctt
tatattgacgatggcaagaggatggagatgggaggagagggggatgggtggagttttgtg
aggttttatgggggttttgtgggtggtggggtggtgagggtgaggtcagaggtggagaag
ggaggttttgcttccggtcaggggttggtcataaagaaggttgtttttccaggattaggg
gatggcatgaaccccaaaactttgagtttgattgtggaggggaagggtatggatttgaat
ggtgctggggcaagtctgaacaatggagttgcagagatcaatggattgtctctactgata
gggaaagagtttgatttgagaatgaatatggaacaaaaaatccttatcaactaa

DBGET integrated database retrieval system