KEGG   Amborella trichopoda: 18428583Help
Entry
18428583          CDS       T02990                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
atr  Amborella trichopoda
Pathway
atr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:atr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18428583
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     18428583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu fn3_5
Motif
Other DBs
NCBI-GeneID: 18428583
NCBI-ProteinID: XP_006837962
UniProt: W1NYZ2
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MQALLAAMAAHTVFAASTWHSPALVSLSSPVTLHSYFRGASLKVSNQSFTLSPAAISRRL
TIVAATKKAVAVLKGNSQVEGVVTLTQEDDGPTTVNVRITGLTPGKHGFHLHEFGDTTNG
CMSTGAHFNPKKLTHGAPEDEIRHAGDLGNIVANADGVAEATIVDNQIPLSGSNAVIGRA
FVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcactcctggctgcaatggccgctcacacagttttcgccgcctctacttggcat
tctcctgccctcgtttctctctcctctccggtcactctgcactcttatttcagaggtgca
tctctcaaggtgtcgaaccagtcctttaccctctcccccgccgctattagcaggcgtctc
accattgttgcggccaccaagaaagcagtcgctgttctcaagggaaactctcaggttgaa
ggggtcgtcaccttgacgcaggaagacgacggtcctacaactgtgaatgttcgcataact
ggacttactcctgggaaacatggattccatcttcatgagtttggcgacactaccaatgga
tgcatgtcaacaggagcacatttcaaccctaagaaactcacacatggtgctcctgaggat
gaaatacgccacgcgggtgacctgggaaacattgttgccaatgcagatggagttgctgag
gcaaccatcgtggacaaccagataccattgtctgggtctaatgctgtcattggaagagcc
tttgttgtgcatgagcttgaggatgatcttggaaagggagggcatgagcttagtctaact
actggtaatgcgggtggaaggctggcatgtggtgtggttggactaacaccggtctaa

DBGET integrated database retrieval system