KEGG   Amborella trichopoda: 18429064Help
Entry
18429064          CDS       T02990                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
atr  Amborella trichopoda
Pathway
atr00010  Glycolysis / Gluconeogenesis
atr00020  Citrate cycle (TCA cycle)
atr00620  Pyruvate metabolism
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
atr01200  Carbon metabolism
Module
atr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18429064
   00020 Citrate cycle (TCA cycle)
    18429064
   00620 Pyruvate metabolism
    18429064
Enzymes [BR:atr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     18429064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA
Motif
Other DBs
NCBI-GeneID: 18429064
NCBI-ProteinID: XP_006838420
UniProt: W1P030
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MASLLSSRVSPSSSLCNLSFSHSLGDKTLPKCHTRRLHFRPVKSTTIRAKIREIFMPALS
STMTEGKIVSWVKSEGDLLSKGESVVVVESDKADMDVETFYDGILAAIVVKEGESAPVGA
PIGLLAETEDEIAEAKAKAASSSSSVSSPVPPSPPPSPSPSSSPTPPISRVSSGKIVATP
YAKKLANQQKVDLNKVIGTGPYGRITPSDIEAAAGIAKPSNLGAPSAIPTVASSPSPPPP
QQSSPPPPTVKGGAGSSGSSVQGGGSTVVPFTTMQGAVSRNMVESLPVPVFRVGYSVTTD
ALDALYKKVKSKGVTMTALLAKATAMALAEHPVVNASCKDGKSFTYNASINIAVAVAIDG
GLITPVLQDADKADLYLLSQRWRELVDKARAKQLQPHEYNSGTFTVSNLGMFGVDRFDAI
LPPGQGAIMAVGASKPTVVTGGDGFFSVKSKMQVNVTADHRIIYGADLSAFLQTFAKIIE
NPESLTL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctgctctcgtctagggtttctccatcctcttctctatgcaacctctctttc
tcacactcccttggtgataaaaccctacccaaatgccatacccggcgcctccatttccga
cctgtgaaatccacaacaattagggcgaaaatcagagagattttcatgccagctctgagc
tctaccatgactgagggtaagattgtttcgtgggtgaaatcggagggggatcttctctcg
aaaggcgagagtgtggtggttgtggagtctgataaggcggatatggatgtggagaccttt
tatgatgggatattggccgccattgttgtaaaggaaggcgaatctgcacctgtcggagct
ccaattggtcttcttgctgagactgaagatgaaattgcagaggccaaggctaaagctgca
tcttcttcatcgtctgtgtcatcacctgtaccaccatcaccacctccatctccatcacca
tcatcatcaccaacaccacctatttctagggtctcttcgggtaagattgtggccacacct
tatgcaaagaagctggcaaaccaacagaaggttgatttgaataaggttatcgggactgga
ccttatggtcgaattactccctctgatattgaggcagctgcaggtatagccaaaccttcg
aatttgggggcaccgagtgccattcctacagtggcttcatctccttctcctcctccgcct
caacaatcctctcctcctcctcctactgttaagggtggtgctggctcttcggggtcttca
gtccagggtggtgggtcgaccgtagttccttttactacaatgcaaggggctgtttcgaga
aacatggtcgagagcctcccggttccggtgtttagggttgggtactctgtgactacggac
gccctggatgctctctataaaaaggtgaagtcaaagggggtcaccatgactgcacttctc
gcaaaggccacagcaatggccttagcagagcatccagttgtgaatgcaagttgcaaggat
ggaaagagttttacttacaatgctagcatcaatattgcagtggcggtggccattgatggg
ggcctaataactccagttctgcaggatgctgataaggcggatttgtatttgctttcacaa
cgatggagggagttggttgataaggcccgagcaaaacagcttcaaccgcatgagtacaac
tcagggacatttactgtttccaatttgggaatgtttggagttgacagatttgatgcaatc
cttcctccaggccaaggagcaatcatggctgttggagcatccaagccaacagttgtgact
gggggagacgggttcttcagtgtgaagagtaaaatgcaggtgaatgtgactgccgatcac
cgaataatatatggggctgacctgtcagccttcctccagacgtttgcaaagatcattgaa
aacccagagagcctaacattgtag

DBGET integrated database retrieval system