KEGG   Amborella trichopoda: 18431638Help
Entry
18431638          CDS       T02990                                 

Definition
(RefSeq) double-strand break repair protein MRE11 isoform X1
  KO
K10865  double-strand break repair protein MRE11
Organism
atr  Amborella trichopoda
Pathway
atr03440  Homologous recombination
atr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:atr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    18431638
   03450 Non-homologous end-joining
    18431638
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:atr03032]
    18431638
   03400 DNA repair and recombination proteins [BR:atr03400]
    18431638
DNA replication proteins [BR:atr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     18431638
DNA repair and recombination proteins [BR:atr03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     18431638
    BRCA1-C complex
     18431638
   NHEJ (non-homologous end-joining)
    MRX complex
     18431638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 18431638
NCBI-ProteinID: XP_020521203
LinkDB All DBs
Position
Unknown
AA seq 762 aa AA seqDB search
MTEDSSREDFSNTLRILVATDCHLGYMEKDEIRRLDSFQAFEEICSIAEQKQVDYLLLGG
DLFHENKPSRTTLVRAIEILRRYCLNDRPVQFQVVSDQTVNFLNTFGHVNYEDPHYNVGL
PVFSIHGNHDDPLGVDNLSAMDILAACNLVNYFGKMALGGSGVGQITLYPILIRKGSTSV
ALYGLGNIRDERLNRMFQTPHAVQWMRPEAREGCSLSDWFNIFVLHQNRIKSNPKNAINE
HFLPRFLDFVIWGHEHECLIDPQEVPGMGFHVTQPGSSVATSLIEGEAKAKHVLLLEIKG
SQYRPTRIPLKSVRPFEYAEVVLKEQTDIDPNDQNAVLEHLDKVVRNLIESSRRKSAGQA
ETKLPLVRIKVDYTGFMTINPQRFGQKFVGKVANPQDILIFSKAAKKRQSLEGKLENSKE
PMGEKHYEMSCCMLALDMRRRTGKIEDSERLRPEELNQQNIEALVAESNLKMDVLPVNDL
DVALHDFVNKDDKMAFYSCVQYNLEEIRNKLTKEADPLQLKEEEDLILKVGHCMQQRENE
RSLRAKEGGQSASSSQMWQDSRGKRAVGVGSSHTFSDDEDGDQMASSLNASNTNNYSKQK
RDSSVASRGGTGKRGRGRGRGGGSSGLKQTTLEATMRSRHSQRSASIAASTAARSIAVDE
EDSVDSGSSGEPRKEELDKAVDSSEPENIPQPSKGRKRAAPRGRGRGSSLTPKRGRKSDN
SVIQKMFMNDDDDDEDESSNRLKKTQPQVTRNYGALRRGGRN
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagattcatcaagagaggatttcagcaatacacttcgaattcttgttgcaaca
gactgccaccttggttatatggaaaaggatgaaatacgtcgacttgattcctttcaggcc
tttgaggagatatgctcaatagcggagcagaaacaagtagactacttactccttgggggt
gatctttttcatgaaaacaagccttcaagaaccactctcgtgagagctattgagatcctg
cgtcgctattgcctcaatgaccgacctgtgcagttccaagttgttagtgatcagacagta
aacttcttaaacacatttggtcatgtaaactatgaggatcctcattataatgttggcctc
ccagtattcagtattcatggcaaccatgacgacccattaggagtggataacctatctgca
atggatatccttgctgcatgcaatcttgtaaattattttggtaaaatggctcttggaggt
tctggtgttgggcagattacactttatcccatactcatcagaaagggttcaacgtcagtc
gccctatatggacttggtaatattcgggatgaacggctgaaccgaatgtttcagaccccc
catgctgtgcaatggatgcgacctgaagcgcgagaaggttgttccttgtcagactggttc
aacatttttgtccttcatcaaaacaggatcaagtcaaatccaaaaaatgcaataaatgag
cacttccttcctagattcttggactttgtcatatgggggcatgagcatgaatgccttatt
gacccacaggaagttccaggaatgggttttcatgtaacacaaccaggatcttctgtggca
acatctctcattgaaggggaagctaaagctaagcacgtgcttcttttggaaattaaggga
agtcaataccgtccaactagaatacctttgaagtcagttagaccttttgaatatgctgag
gttgtactgaaggagcagactgacattgatccgaatgatcaaaatgctgttcttgagcat
cttgacaaagttgtgagaaatcttattgaaagtagtcgccgaaaaagtgctggacaagct
gaaacaaagctaccattagttcgaataaaggtagattatactgggttcatgacaataaac
cctcaaagatttggtcaaaagtttgtgggaaaggtagcaaatccacaggacattcttata
ttctcaaaggctgcaaaaaaacgtcagtctctggaagggaaacttgaaaattcaaaggaa
ccaatgggggagaagcactatgagatgtcatgctgtatgcttgccttggatatgcgacgc
cggacaggaaaaattgaggattctgaaagacttcgtccggaggagttaaatcaacaaaat
atagaggctctagtcgccgaaagtaacttgaaaatggatgttcttccagtgaatgacttg
gatgttgcattacatgattttgtgaacaaggatgacaaaatggccttctattcttgtgtc
caatacaatctagaggagatacgtaataaacttaccaaggaagcagatcctctgcaactg
aaagaggaggaagatttgatcctcaaagtgggtcactgtatgcagcaacgtgaaaacgag
agatccttaagggccaaggaaggtggccaatccgcatctagttcccaaatgtggcaggat
agtcgagggaagcgtgcagtgggtgttgggagttcacataccttcagtgatgatgaggat
ggtgatcagatggcatcaagcttgaatgcttcaaacaccaacaattattctaaacaaaaa
cgtgacagttctgtagcttctcgaggaggaactggtaagagaggcagaggcagaggcaga
ggtggaggttctagtggtttgaagcaaacgactttggaagcaaccatgagaagccgccat
tcacagagatctgcatcaattgctgcttctactgcagctcggagcattgcagttgatgaa
gaagatagcgttgattcaggctcaagtggtgaaccaagaaaggaagaactggataaagct
gttgatagctcagagcctgaaaacattccccagccaagtaaagggcgcaaaagagcagct
cctaggggcaggggaaggggttcttccttaaccccaaaaagaggaaggaaatcagacaac
tctgttatccagaaaatgtttatgaatgatgacgacgacgatgaggatgaatcatccaac
agattaaagaaaacccaacctcaggtaactcggaattatggtgctttgaggaggggagga
aggaattag

DBGET integrated database retrieval system