KEGG   Amborella trichopoda: 18433807Help
Entry
18433807          CDS       T02990                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
atr  Amborella trichopoda
Pathway
atr03030  DNA replication
atr03410  Base excision repair
atr03420  Nucleotide excision repair
atr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:atr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18433807
   03410 Base excision repair
    18433807
   03420 Nucleotide excision repair
    18433807
   03430 Mismatch repair
    18433807
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:atr03032]
    18433807
   03400 DNA repair and recombination proteins [BR:atr03400]
    18433807
Enzymes [BR:atr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     18433807
    6.5.1.6  DNA ligase (ATP or NAD+)
     18433807
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     18433807
DNA replication proteins [BR:atr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    18433807
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     18433807
DNA repair and recombination proteins [BR:atr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     18433807
   NER (nucleotide excision repair)
    Other NER factors
     18433807
   MMR (mismatch excision repair)
    Other MMR factors
     18433807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL UBA_4 Pox_L5
Motif
Other DBs
NCBI-GeneID: 18433807
NCBI-ProteinID: XP_020522813
LinkDB All DBs
Position
Unknown
AA seq 1463 aa AA seqDB search
KLLKPCLLQLDNESLMASLPNSSSTETLELNSQEIFTSSYEAFSQIAARPSQPLAFKLLS
QQSSLKPFPQNFPSSKRIPGTTFVIDGFRSSGPFSVTYFLSHFHSDHYCGLSPNWSRGLV
FCSHITARLLIECLNLSPLFVIPLALGRTVEIDGWDVTIVDANHCPGAVQFLFKNLDCNG
VLSRYLHTGDMRLSNSMKSDPILSEFIGCDVVFLDTTYCNPRFCFPAQDKSIDYVVRTIA
KIRKEKVGSVLFVVSTYVVGKEKLLLEISRQCGCLLYVDSRKMSILNALDLGESDAFTVD
PSATDVHVVGWNFLGEIWPYFRPNFGNLNKITVERGYHRAVGFVPTGWMYETKRDGFSVR
SKNSFEIHLVPYSEHSSYNELREYVGFLRPKRVVPTVGLEDGKLDGKQVSEMQKHFAGLV
DELANKQDFLMGFSKRSSLQINGDSNGEVGEKLEASLEKRIIEGKSLRLQPRVLPLMAVK
SAEGSAIYLDLEKDVSLKPVVLDTIAITDSDAMNDMNMRQAIEDLRYCLPNWVTMNQMVE
LLTCSGGDIVEAASNFFEREIEFHEHALLEANPSENISKEVVGSPQMSSILNSTSTTEGE
SLKGCDLGTSKGSLLKVKSLANINFPTKKSSTPKRRGMKAENRLKKKLKSPSNPVYNDGK
QSTITRFFSKVGPAVLHNSGSGEPITEQSPIDIGMVVDNVYRSYDYENELSHFLEIIDCA
TSREDAAVLVGKSKGDINLALEMYYSQASVEEGRLLPSASAQIGSSNVNFNGNGMSDNAC
LKTVSMPSLSAQGFTMANPVAKSVWLPLEKYSPVEDACWTSGEPAPYLHLARTFSLLETE
RGKLKVTAMLCNMFRSLLALSPDDVLQAVYLCTNKIAPDYENVELNIGGSMVSSAIKEAC
GTNKAKIQELYNTLGDLGDVAQACWQSQSFLALPSPLSIRHVFYTLRQISKEAGIGSADR
RKKLIVNLLHSCREKEIKFLVRTLVRNMRIGASMRTVLPALAQAVVLNSSPQGALDGLKL
QLQGLSAAVLEVYNILPNLDLLVPALMRERTEFSAANLSMLPGIPIRPMLSRITNGVSHA
LKKFEGRAFTCEYKYDGQRAQIHKLMDGSIRLFSRNGEETTCRFPDLVKIVQGSCKPTAM
TFILDTEVVAVDHKNGNKILPFQHLSSRERGGNDSVVTLDSIKVDICVFIFDIMFADGKQ
LLNYPLRQRRQYVKDLFHNENRGYLEFAKELTVEGNEACLSSLATVVKMNSFLEDAFNSS
CEGIIVKSLDVDAEYAASKRTDTWLKVKRDYVEGLNDTLDLVPIGAWHGNGRKAGWFSPF
LMACYNPDTEEFQSVCRVMSGFSDTFYIEMEEFFSGDKILGRKPAYYQTADKPDFWFSTE
LVWEIRGADLLTLNEITCMADLTISPVHQAAFGLVHPSRGISIRFPRFIRTVTDRKPEDC
TTAMDIADMFNRQTRKLDVDIDE
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
aaacttctgaaaccttgtcttttgcaactggataatgaatcgctaatggcttctcttccc
aattcttcttccactgaaaccctagaacttaattcacaggaaatattcacatcatcctat
gaagctttctctcagatcgctgctcgcccatctcaaccccttgctttcaagcttctctct
caacaatcttccttaaaacccttccctcaaaatttcccttcatcaaaacgaattcctggt
actacatttgtaatcgatgggtttcgatcatctggtccattctctgtaacctacttttta
tctcattttcactctgaccactactgtggtttgagccctaactggtctcgaggcctcgtg
ttttgctctcacatcactgcacgcctccttattgaatgtctcaatctctctcctctcttt
gtcatccccctagccctaggtcgcactgtcgaaattgatggctgggatgtgacgattgtt
gatgcaaaccactgtcctggagctgtccaattcttattcaagaacctcgattgtaatggc
gtgctttccaggtatcttcacactggcgatatgaggctctctaattcaatgaaatctgat
ccaattctcagtgaatttataggctgtgatgttgtttttcttgatactacttactgtaac
cctagattttgtttccctgctcaagacaagtctattgattatgtagtgagaaccatagcg
aaaattaggaaagaaaaggtggggtcagttctttttgtggtttcaacttatgtggtgggt
aaggagaagcttttgctagaaatttctaggcagtgtggctgcttattatatgttgatagt
cggaaaatgtcgattctaaatgctttggatttgggtgaaagtgatgctttcactgttgat
ccttccgcaactgacgttcatgtggtgggttggaattttttgggggaaatatggccatat
tttcgccctaattttgggaatttaaataagattacggtcgaaagggggtaccatagggca
gttggttttgttcctacagggtggatgtatgaaacaaagagggatgggttttcagttagg
tcaaagaattcatttgagattcatcttgttccatatagtgagcattcgagctacaatgag
ctcagggagtatgtgggtttcctcaggccaaaaagagttgttcccactgtgggtttggaa
gatgggaaacttgatggtaagcaggtgagtgagatgcagaagcactttgctggtttggtt
gatgaattggcaaacaagcaagacttcttgatggggtttagtaaaagatcatctttgcaa
atcaatggtgactcgaatggagaagtgggtgaaaagcttgaggcttcacttgagaaaaga
atcatagaaggaaagtctttgcgattacaacctagggtcttgccattgatggctgtcaag
tcggctgaaggctcagccatatatttggatctagagaaagatgtatcgttgaagcctgta
gtgttagacactattgcaattacggattctgatgctatgaatgatatgaacatgcgccaa
gctatagaagacctgcggtattgccttccgaactgggtcactatgaatcagatggtggag
ttattaacttgctcagggggtgacatagtggaagcagcttccaatttctttgaacgtgaa
attgagtttcatgaacatgctctattagaagccaatccttcagaaaatatatctaaggag
gttgttggcagtcctcaaatgagctcgattctcaattccacttccactacagaaggggaa
tctttgaaaggttgtgatcttggaacttctaagggaagcctcttaaaagttaagtccctg
gccaacataaattttcccaccaagaagagctctactcccaaaagaagaggaatgaaagca
gagaacaggttgaagaagaaattaaaatcgccctcaaatccagtatataatgatgggaaa
cagtccactataaccagattctttagtaaagttggcccagctgttttacataattcaggt
tctggtgaacccataactgaacaatctccaattgacattggtatggtggttgataatgtc
tacagatcatatgactatgagaatgagttatctcattttcttgagataatagactgtgct
acatctagggaagacgctgctgttttggtaggaaagtccaaaggagatatcaatctggca
cttgagatgtattatagtcaagcttctgttgaagaagggcggcttttgcccagtgcatca
gctcaaattggcagtagtaatgtgaactttaatggtaacggaatgtctgataatgcttgt
cttaaaacggtcagcatgcctagcttgtctgctcagggatttaccatggcaaaccctgtt
gcgaaatctgtatggctacctcttgaaaagtattctcctgttgaggatgcgtgttggact
tctggggaaccagctccatatttacatcttgcacggacattttctttgctggagacagaa
cggggaaagctaaaagtcactgctatgctttgcaacatgttcagaagcttgcttgccttg
tcacccgacgacgtgctccaagctgtatatctctgcaccaataagattgctcctgattat
gaaaatgtggaactgaacattggtggcagtatggtctcttcagcaataaaggaggcatgt
ggaacaaacaaggctaaaatacaagaattgtacaatactttgggtgatttgggagatgtt
gcacaggcttgttggcagagtcaatcatttcttgctcttccaagcccgctttcaattcgt
catgtattttatacacttcgacagataagcaaggaagcaggtattggaagtgctgatcga
aggaagaagctcattgtaaatcttcttcattcttgtagggagaaggaaataaagtttctt
gttcgaactttggtgcggaacatgcgtatcggggcctcaatgcgaactgttttgcctgca
cttgcgcaagctgtggtgctgaattcctcacctcaaggagctttggatggccttaaatta
cagcttcagggcctatctgcagcagttcttgaggtgtataatatactgcccaatttggat
ctactggttcctgcactcatgagagaaaggactgagttttctgcagcgaatttgtctatg
ctccccggcatacccattaggcccatgctttctagaattaccaatggagtttctcatgcc
ttgaaaaagtttgaaggaagagcttttacatgtgaatataaatatgacgggcagcgtgct
caaattcacaaattgatggatggttctatacgtttattttcacggaatggggaagaaaca
acgtgcagatttccagatctggtgaagatagtccaaggatcatgtaaacctactgcaatg
acttttatattggatactgaggttgttgcagttgatcataagaatgggaataagatcctg
cccttccagcatttatcttcacgtgaaagggggggtaatgattctgttgtcacacttgac
agtataaaggttgacatttgtgtctttatctttgatataatgtttgcagatggaaaacag
ttgttgaattatccactacgtcaaaggagacagtatgtgaaggacttgtttcacaatgaa
aatcgtggttacttggagtttgcaaaggagttgacggtggagggaaatgaagcatgcttg
agctctctggctacagtggttaagatgaactcatttctcgaagatgcatttaactcctct
tgtgaaggaataatagtgaagtctctcgatgttgatgctgagtatgctgcctcgaagcgt
actgacacatggttaaaggtcaaacgagactatgttgagggtttaaacgacactctagac
ttagtacctattggggcctggcatgggaatggaagaaaagcaggatggttcagccctttc
ctcatggcatgctataacccggacacagaagaattccaaagtgtgtgtcgtgtcatgtct
ggattttcagatactttctatatagagatggaggagttcttctccggggataagattcta
ggcaggaaaccagcatactaccagacggctgacaagcctgacttttggttttctacagaa
cttgtgtgggaaataagaggtgcagacttactgactttaaatgaaataacatgcatggca
gaccttacgatatctccagttcaccaggcagcatttggtttggtgcatccctcacggggc
atttcgatacgatttccaagattcatacgtacagtgaccgataggaaaccagaggattgc
accactgctatggatattgctgatatgttcaacaggcagacaagaaagctggatgtcgac
attgacgagtga

DBGET integrated database retrieval system