KEGG   Amborella trichopoda: 18434098Help
Entry
18434098          CDS       T02990                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
atr  Amborella trichopoda
Pathway
atr00010  Glycolysis / Gluconeogenesis
atr00053  Ascorbate and aldarate metabolism
atr00071  Fatty acid degradation
atr00280  Valine, leucine and isoleucine degradation
atr00310  Lysine degradation
atr00330  Arginine and proline metabolism
atr00340  Histidine metabolism
atr00380  Tryptophan metabolism
atr00410  beta-Alanine metabolism
atr00561  Glycerolipid metabolism
atr00620  Pyruvate metabolism
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18434098
   00053 Ascorbate and aldarate metabolism
    18434098
   00620 Pyruvate metabolism
    18434098
  09103 Lipid metabolism
   00071 Fatty acid degradation
    18434098
   00561 Glycerolipid metabolism
    18434098
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    18434098
   00310 Lysine degradation
    18434098
   00330 Arginine and proline metabolism
    18434098
   00340 Histidine metabolism
    18434098
   00380 Tryptophan metabolism
    18434098
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    18434098
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    18434098
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     18434098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 AAA_25
Motif
Other DBs
NCBI-GeneID: 18434098
NCBI-ProteinID: XP_006844236
LinkDB All DBs
Position
Unknown
AA seq 535 aa AA seqDB search
MVICTRGLSSLLMRAVRSSFIYPHGRNLNNRHIRMFSSAVAAEEPITPPVQVEYTQLLIG
GKYVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVSAARKAFDDGPWPRMTAYERSR
ILYRFADLVEKHNDELAALETWDNGKPYEQASLAEIPMFVRLMRYYAGWADKIHGLVVPA
DGPHHVQVLHEPIGVAGQIIPWNFPLLMYAWKVGPALACGNTVVLKTAEQTPLSALLVSK
LFLEAGLPAGVLNVISGYGPTAGAALASHMDVDKLAFTGSTVTGQAVLNLASKSNLKPVT
LELGGKSPFIICEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKAKARA
MKRVVGDPFKKGVEQGPQIDLEQFNKIMGYIKSGVDSGATLELGGERIGTKGYYIQPTIF
SNTKDSMPIATDEIFGPVQTVFKFKDLNEVIQRANASRYGLAAGVFTKNIDTANTLSRAL
RVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIQSLSNYLQVKAVVQHLRNPAWL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggtgatctgtacccgtggactgtcctctctcctaatgagagccgtccgatcatccttt
atctatcctcatggaagaaatcttaataacaggcacatccgtatgttcagctctgcagtt
gcagcagaagagccaatcactccgcctgttcaagttgaatacacacagcttcttattggt
ggaaaatatgtcgattcagcatcaggcaagacatttccaaccttggatcctaggacagga
gaggtgatagcccacgtagcagaaggagatgcagaagacatcaatagggctgtctctgct
gctcgcaaggcatttgacgatggaccatggccaaggatgactgcttatgaaagatcaagg
atactataccgttttgcagatttggttgaaaagcacaatgatgagcttgcggcacttgaa
acatgggataatggaaagccttatgagcaggcttccttagctgaaattccaatgtttgta
cggcttatgcgatattatgctggttgggcggataagatacacgggcttgtagttccagct
gatggaccccaccatgtgcaagtcttacatgaacccattggagttgctgggcaaatcatt
ccttggaattttccacttcttatgtatgcttggaaggtggggccggcgttggcttgtgga
aacactgtcgtcttgaagactgcagagcaaacacctttatcggccttactcgtatctaaa
ttgttccttgaggctgggcttcctgcaggtgtactgaatgtgatttctgggtatggtcca
actgctggagcagctcttgctagccacatggatgtggacaagcttgctttcactggatca
acagtcactggtcaggctgtacttaacttggcatcaaaaagcaaccttaagccagtgact
ttagagcttgggggaaaatccccttttattatatgcgaggatgctgatgttgatcaggct
gttgaacttgcccattttgcattgttctttaatcagggacaatgttgctgtgctgggtcc
cgaacttttgtacatgagcgcatttatgatgaatttttggagaaggcaaaagcacgtgct
atgaaacgtgttgtgggtgatcctttcaagaagggtgttgaacagggtccgcagatcgac
ttggaacaattcaacaagatcatgggttacataaagtctggtgttgatagtggggccaca
ctcgaattggggggagagagaatcggtaccaagggctactatatccagcccacgattttc
tcgaacaccaaggatagcatgccgatagccactgatgaaatatttggcccagttcagacg
gtgttcaagttcaaggacctcaatgaggtgatccaaagagcaaacgcatcacgctacggt
ttggctgccggggttttcacgaagaatattgacacagccaacaccctatcgcgagcactg
agagtgggtacagtatgggtcaattgctttgatgtgtttgatgctgccattccctttggt
gggtataagatgagtggggtggggagagaaaagggaattcagagcctgagtaactacttg
caagtcaaggctgtagtccagcacttgagaaatcctgcatggctataa

DBGET integrated database retrieval system