KEGG   Amborella trichopoda: 18436881Help
Entry
18436881          CDS       T02990                                 

Definition
(RefSeq) uncharacterized protein LOC18436881
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
atr  Amborella trichopoda
Pathway
atr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    18436881
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:atr03036]
    18436881
Enzymes [BR:atr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     18436881
Chromosome and associated proteins [BR:atr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     18436881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW PP2C_2
Motif
Other DBs
NCBI-GeneID: 18436881
NCBI-ProteinID: XP_011624372
LinkDB All DBs
Position
Unknown
AA seq 2441 aa AA seqDB search
MECIECLDIGGSSGLSCDDKEDFRACINTSCGPAIEDDYGSKKMVEFSNDERWSGVEKIE
EVLPKGDDFGERLFPEFEHMIDKEYPVCDSHVLLNEEMPMPLLTVSTSMGSAMALQEEKK
QEDSVCINSKEAEPNRPILNMELEESKPGALIKGSPEMGSCNSSERFASLVSQFLEGTKA
SASSNGQFVSANASQLASREIKKQEVGVFVKSKETETDDPMSHMFLKGGKAGILTEGSPE
IDSSNSSAGYASLVSKFLEVTKATASSDLQFASTNSSALALQEKKKQTDGVTVNSKESEA
NLQMPIMLPEENMPGVSNERSSRMGSYISGNSFASLVSKFIEVTNASSSSSIYYLSSDAS
ALAFQEEKKQADGVYVNLKENESNKPISSWLLEESKPVALTEGSPEMGSCNSGDGFASLV
SQFLEGKKVSASSSSQPVSADVNARSCLSGALASSSGHGEREYFNIGNTIVKPGVTVTEC
AHSSSSSKKFSTPIRVFGRLTRARKAARDKNMAAALLLKDASWFFNKTKGKRSVISKAAR
SSVWGGLGSLIQVFQVQQSDNAASGFPLELVKSIGGKKVERGRSRGRYRAKAKVSTKSQK
PKNPAQVKSRRAKAQRKDQLIAKESPLSLYHHDGGNVNLSVGCLKSEAMDNNSGMFKASH
EISNENSKAAMENFDVKFGLDGCDTKQVHEVAVQDASVDGFKKSVLSVDVDVPIGDLKHG
DKDSESTLTQDTTAENLIGSSSFMLSSFEYGVDALGEGFSSMHLDFGASPHLMDSDETER
NATVTDRKDDLCLHETLQCGRSFPVTADTSLSSQELSEKRFCCKIPSHGMDSTTETTYLE
DLQDEAPTCSQAGIDPIITPPLDLKQYGRKKGRRKEEGSRNQSLLFADLPKQETLQGDLL
VSVNQSTARRSTKSRSEQTSKRSSKPRKNSDLKSMGNPFGENCRDGELYVEQAPLRIREF
KMDQGAMELASSCERITLSGPMGIGAAPSEEAGGEMLQLNANKKAQRHPKKSNEVNKCGS
YTPTSGGCKKGRGNGSQKKKVVPGQHATLTGSSDKEQETLQDQWRKDGGKGAAVQDGAGS
VILGESGANAVNKSALDAEVQSLPPRVAWVLCDDCQKWRCIPATLADIIEETNCKWTCKD
NLDKAFADCSIPQEKSNAEINAELDISDASGEEDNCGSRHCPKGLDARQLTASQQMSWTL
IEHNIFLHRSRKSQTIDEIMVCHCKSPVDGILGCKDDCLNRMLNIECVQGTCPCGDLCSN
QQFQRRKYANFKWIRCGKKGYGLQLQEDVSQGDFLIEYVGEVLDMATYEARQKEYAARGQ
KHFYFMTLNGNEVIDACVKGNLGRFINHSCEPNCRTEKWIVNGEVCIGLFAIRDIKKGEE
VTFDYNYVRVFGAVAKKCVCGSSECRGYIGGDPLNPEAVVHSDSDEDYPEPVMIHENGGT
GILADDTISNNGRTEILADDTNSSTKGNSITGISANDTISKTEEIGGTEILAIDNISNSK
EAGRTEILANEYNSIMKEDGGAEILANDNNSNLKENGRTEVIYDDSNNTCSTNWTDAVVP
REIASLPAGDVSNRPIADNMEVSHKDKKAVSSIKKSSRSIKMGRSNTNQLKASKPRKLLP
GIDRGRFEGVDEKLNELLDAEGGISKRKDATKGYLKLLFVTAACGDNVHGEAFQSTRDLS
LILDALLKTKSRMVLVDIVNKNGLQMLHNIMKQNRRNFNKIPIIRKLLKVLEYLATKEVL
TLEHINSSPPRAGIESLKESILKLTWHNDVQVHQIARSFRDKWIPRTTRKAKYSDREGAD
YHHQSNGRNGHWNRFHKRWQSPALRHSDAIECKSRALEPVPVSSSPSLPKNPPSPPVVCA
NTDKQTDATPSSTTTNGTRRRKRKSRWDQPKDGEEEQPSLNTEHRQCSEVMPDHPPGEKL
VSSLAESVQAPLTIESSSHSTLVRAVPCSEGAHLDDEKVPPGFSVPSGTQTAYPEEQRFE
CNAQKKSFIGSQLCPAEQHSPLGFQSPPLPSPFPKEQRRRHNDAAKYHSHPCDYDEHSVP
PGFPPPSCNAQVNSLSPVEQGCGMANKGYDEQIPPGFQPPLSSPQVVPTPPNSSAVALDP
PSYQHNSWGVNQQGTTCISPSVPSSFPGAPRPQAPNFQTNPIGSSIGGAPPMPTLNWSLP
PPRPPPMPFQLLPPPPPGPPPLHHMVRPPCSEEIMRSPQFVPHVLGPAPSQPVPINPPLP
PGPPPASARPVSGSFPCGSHSPPLAPQPMLAAPFQCMPPPTNQPMPPFHCPPPPPPPPPP
PPPPPPNPPMMHGDPFPMQNQATMPPPPLPNTCNAVPQRQNQAPMQPPPPPITNCNVVPN
SREEGSSSYAPPQPCVGGTATAGGMGRRWGGPQHRCDHVPPWQRSRNNNNSNNHHNSWSA
RGCSRGGFNGFNGKCFRKGGSGGGSSGANKNFSSTHHHHHH
NT seq 7326 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcattgaatgcctggacattggaggttcctctggtttgtcatgtgatgacaaa
gaggattttagggcgtgtataaatacttcttgcgggcctgcaattgaagatgattatggg
tcgaagaaaatggtggaattcagcaatgacgagcgctggtctggtgttgaaaagatagaa
gaggttcttcccaaaggtgatgatttcggtgagagattattcccggaattcgagcatatg
atcgacaaggaatacccagtatgtgattcacatgttttgctcaacgaggaaatgccaatg
ccgttattgacagtgtctacgagcatgggaagtgcaatggccttgcaagaggagaagaag
caagaagatagcgtctgcattaattccaaggaggctgagcccaataggccaatcctcaat
atggagctcgaagagagcaagcccggtgcattgatcaaggggtcacctgaaatgggttcg
tgcaactccagtgaaaggtttgcttccttggtgtctcagttcttagaaggtacgaaagcg
agtgcttcttctaatggacagtttgtatcagccaatgccagtcaattggcctcacgagag
ataaagaagcaggaagttggtgtttttgtgaaatcaaaggagactgaaaccgatgatcca
atgtctcatatgtttctcaaaggggggaaggctggtatattgaccgaggggtcacctgaa
attgattcctccaactctagtgctggatatgcttctcttgtgtctaagttcttagaagtt
acaaaagcaactgcttcttctgatttacagtttgcatcaactaattccagtgcattagca
ctccaagagaaaaagaagcaaacagatggtgttacggtcaattcaaaggagagtgaagcc
aatctgcaaatgcccattatgttgcctgaagaaaacatgcctggtgtgtcgaatgagcgt
tcatctagaatgggttcttacatatcaggcaatagctttgcttctttggtttctaagttc
atcgaagttacaaatgctagttcttcttccagcatttattatttatcatctgatgccagt
gcactggccttccaagaggagaagaagcaggcagatggtgtttatgttaatttaaaggag
aacgaatccaataagcctatctccagttggttgcttgaagaaagcaagcctgttgcattg
actgagggatcacctgaaatgggttcttgtaactcaggtgatggttttgcttctctggtt
tctcagttcctagaaggtaagaaagtgagtgcttcctctagttctcagcctgtatcagct
gatgtgaatgctcgaagctgtcttagtggtgcattggcttcttcttctggacacggtgaa
agggaatattttaatattggtaacactattgtgaaacccggcgtcactgttactgaatgt
gcacattcttcgtcttcttcgaagaaatttagtacaccaattagagtatttgggcggtta
acgagagccagaaaagctgcaagagacaaaaatatggctgctgctttattgttgaaggat
gctagttggttctttaataaaaccaagggcaaaaggagtgtaatctcaaaggcagcaagg
tcctcagtttggggagggttagggagtttgattcaggtgtttcaagttcaacagagtgac
aatgctgccagtgggtttcctctggagctagtcaaaagcataggaggtaagaaagtggag
cgtggaagaagtcggggaaggtatcgtgcaaaggctaaggttagtaccaaatcacaaaag
ccgaagaatcctgcccaagtcaagtctaggcgtgctaaggctcaaagaaaggatcagctg
attgcaaaggagagtcctctttcattgtatcatcatgatggtggtaatgtcaatttaagt
gttgggtgtctgaaaagtgaggccatggacaataatagtgggatgtttaaagcatctcat
gaaatcagtaatgaaaattccaaagcagcaatggaaaattttgatgtcaaatttggactg
gatggctgtgacaccaagcaggtccatgaagtagctgttcaagacgcttctgttgatggg
ttcaaaaaatcagtcttatctgtggatgtagatgttccgattggtgatttgaagcatggg
gataaggattcagaaagcacattgacacaagatacgactgctgaaaacctcattggcagt
tcatcttttatgctctcctcatttgaatatggcgttgacgcattgggagaaggattcagt
agcatgcatcttgactttggggcatcacctcatttaatggattctgatgaaactgaaagg
aatgccactgtgactgacaggaaggatgacctctgtttacatgaaactttacagtgtgga
agaagttttcctgttacggcagacacatctctaagtagtcaggaactttccgagaaacgt
ttttgctgtaaaattccatcacatggaatggactctactacagaaaccacatatcttgaa
gacttacaagatgaggctcctacatgttcacaggctgggattgatcctataattactcca
ccattggatttgaaacaatatggcagaaagaaaggaaggagaaaagaagaaggcagcaga
aaccaaagtttattatttgcagaccttcctaaacaagaaaccctgcagggagatttgctt
gtttcagttaatcagagtacggccagaaggtcaaccaaaagtagatctgagcagacttcc
aaaaggtcatcgaaacccagaaaaaactcagacctgaaaagcatgggaaatcccttcggt
gaaaattgtagggatggggaactttatgtggaacaagcgccattgaggataagggaattc
aaaatggaccaaggagctatggaattggcaagtagctgtgaacgaatcacattatctggg
ccaatgggtattggtgcagctccatctgaggaagcgggtggtgaaatgttgcagctcaat
gccaacaagaaggctcagaggcatcctaaaaaatcaaatgaagtgaataaatgtggatca
tacactcccacttcagggggctgtaaaaaaggaagaggtaatggttcgcagaaaaagaag
gtcgtacctggccagcatgctacattaactggcagcagcgacaaagaacaagaaacactt
caagatcaatggaggaaggatggtggtaaaggagctgctgttcaagatggggcaggttct
gttattcttggagaaagtggtgccaatgcggtaaacaagtctgcgttggatgctgaggtc
cagagtcttccacctcgtgtggcatgggtgctgtgtgatgattgccaaaagtggcgatgc
atacctgctactcttgctgacattattgaggaaacaaactgcaaatggacatgtaaggat
aacttggacaaggcatttgcggactgctcaataccccaggagaagtcaaatgctgaaatc
aatgcagagttggacatatctgatgcctcgggtgaggaagataactgtggttcacgtcat
tgtcccaaaggcctagatgccagacagttgacagcttcgcagcagatgtcttggacgctt
attgagcataatatatttctgcaccgtagccgtaaaagccagacaatcgatgagattatg
gtttgccattgcaaatctcctgtagatggtatcttgggttgtaaagatgattgcctgaat
cggatgcttaatatagaatgcgttcagggtacctgcccttgtggggatttatgctcaaac
cagcagttccaacgaaggaagtatgccaattttaagtggattcgctgtggaaaaaaaggc
tatggcttgcagctgcaggaagatgtttctcagggagattttcttattgaatatgttgga
gaggtgctggatatggctacctatgaagcgcgtcagaaagagtatgcagctagaggtcaa
aaacatttttacttcatgacattgaatgggaacgaggttatagatgcatgcgttaaagga
aatttggggcgtttcataaatcatagttgtgagcctaattgtcgaactgagaagtggatt
gttaatggagaagtgtgtatcggattattcgcaattcgagatattaaaaagggagaagaa
gttacgtttgactacaactatgtccgagttttcggggctgttgcaaagaaatgtgtctgt
ggatcttctgaatgcagagggtatattggtggtgatccattaaatcctgaagctgttgtt
catagtgactctgatgaagactatcctgaacccgtgatgattcacgaaaatggcggaact
gggatcttagctgatgataccatttcgaataatggtagaactgagatcttagctgatgat
accaactccagtaccaaaggaaatagcataactgggatctcagctaatgataccatctca
aaaactgaagaaattggtggaactgagattttagctattgataacatctccaatagcaaa
gaagctggtagaactgagattttagctaatgaatataactccattatgaaagaagatggt
ggagctgagatattagctaatgacaacaactccaatttgaaagaaaatggtagaactgag
gtcatatatgatgatagcaataacacctgcagtaccaattggacggatgctgttgttcca
cgggaaattgcttctttaccagctggagatgtcagtaacagacctattgctgacaatatg
gaagttagtcacaaggataaaaaagctgtttcctcaatcaagaagtcatctagatctatc
aagatgggaaggtctaatacaaaccaacttaaggccagcaaacctagaaaactgctgcca
ggcattgatagaggccgctttgaaggagttgatgagaaactaaatgagttacttgatgcc
gaaggtgggatcagcaaacgaaaagatgctactaaaggatacttgaagcttttgtttgtt
actgcagcttgtggtgataatgtccatggggaggcattccaaagcacacgggatctttct
ttgattcttgatgcacttcttaaaacaaagtcacggatggttttggtcgacatagtgaac
aaaaatggtctgcaaatgctgcataacattatgaaacagaaccgcagaaatttcaataaa
attcctataatccggaagcttctaaaggtactagaatatcttgctacaaaggaagtactt
accttggagcacattaattcaagtcctcctcgtgcaggaattgaaagtttgaaggagtca
atacttaaactgacatggcacaatgatgtccaggtccaccaaatagcacgaagcttccga
gacaaatggatacctcgcacgaccaggaaagctaagtactctgatcgggagggtgctgac
tatcatcatcagtccaatggtcgtaatggccactggaaccgtttccataaacgttggcag
tccccagctttaagacattcagatgcaattgaatgtaaatctcgtgcattggagcctgtt
cccgtctcctcatctccttccctccccaaaaatcccccttcccctccagtggtatgtgct
aacacagacaagcagactgatgccaccccatcgtcaactacaacaaatgggacaagaagg
cgcaaaaggaaaagccgatgggatcagccaaaagatggtgaagaggagcagccttctcta
aacactgaacaccgtcaatgcagtgaagtgatgcctgaccatccaccaggcgaaaaacta
gtttcgagtctagctgagagtgtgcaggccccattaacaattgagagcagcagtcatagt
acacttgtacgagctgttccttgcagtgagggagctcaccttgatgatgagaaagttcct
cctggattttctgttccctcgggcacccagactgcatatccagaagagcaaagatttgag
tgtaatgcgcagaagaaatcatttattggaagtcagttgtgccccgctgaacaacatagt
cctctggggtttcagtcccctccccttccctccccattcccaaaagagcaacgacgacgg
cataacgatgctgcgaagtatcatagtcatccctgtgattatgatgagcattcagtgcct
ccaggtttcccgcctccctcgtgcaatgcacaggtgaacagtttgagcccagttgagcag
ggttgtggcatggcgaacaaggggtatgatgaacaaatacctcctggttttcagccgccc
ttaagcagtccacaagttgttcccacccctccaaactcaagtgctgtagctcttgatcca
ccaagttaccaacacaacagttggggagttaaccaacagggaacaacatgcatatcacct
tctgtgccatcgtcatttcctggagcgccaaggccccaagcaccaaatttccaaacaaac
cccattggtagtagcattggtggtgcaccacctatgccaactctgaattggtcactccca
ccccctcgtcctcctcctatgccttttcagcttctccccccaccacctcctggtcctcca
cctctacatcacatggtccgtccaccatgcagtgaagagataatgcggtctcctcagttt
gttccacatgtgctaggacctgcacccagccaaccggtgcctatcaaccctccattgcca
cctggacccccgcctgcgagtgcaagacctgtgagtgggtcgttcccttgtggctcccat
tcgccaccacttgcccctcaaccaatgctagctgccccgttccaatgtatgccaccccct
acgaatcaaccaatgcctccattccattgtccacctccaccacctccacctccacctcca
cctccacctccacctcccaatcctcccatgatgcatggggatccattcccaatgcaaaac
caggctaccatgcctcctcccccactaccaaacacctgtaatgcagtgcctcagcgacaa
aatcaggctcctatgcagccgccgccgcctccgataaccaattgtaatgtcgtgccaaat
tcgagagaagagggatcatcatcatatgcacctccacaaccttgtgttgggggaactgca
acagcggggggcatgggtaggagatggggtgggccacagcataggtgtgatcatgtgccc
ccatggcagagatccaggaacaacaacaatagcaacaaccaccacaacagttggtcagcc
aggggttgttctaggggcgggttcaatggtttcaatgggaagtgttttaggaagggtggc
agtggtggtggcagcagtggggctaataagaatttttcttctacccatcatcaccaccat
cattga

DBGET integrated database retrieval system