Amborella trichopoda: 18437706 Help Entry 18437706          CDS       T02990                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism atr  Amborella trichopoda Pathway atr03083   Polycomb repressive complex atr04120   Ubiquitin mediated proteolysis atr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:atr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18437706    04120 Ubiquitin mediated proteolysis     18437706   09126 Chromosome    03083 Polycomb repressive complex     18437706  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atr04131]     18437706    04121 Ubiquitin system [BR:atr04121]     18437706    03036 Chromosome and associated proteins [BR:atr03036]     18437706 Membrane trafficking [BR:atr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     18437706 Ubiquitin system [BR:atr04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      18437706    Cul7 complex      18437706 Chromosome and associated proteins [BR:atr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      18437706   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      18437706 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  18437706 NCBI-ProteinID:  XP_006847969 UniProt:  W1PQQ3 LinkDB All DBs Position Unknown AA seq 157 aa AA seqDB search MSKDEKKVTLKSSDGEVFEVEESVAVESQTIKHMIEDDCAGNGIPLPNVSSKILAKVIEY CKYHVDAQKVTEDKTQEEEIKSWDAEFVRVDQATLFDLILAANYLNIKNLLDLTCQTVAD MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaggacgagaagaaagtgaccttgaaaagctcagatggagaggtttttgaggtc gaagagagcgttgcagtagaatctcagaccattaagcatatgattgaagatgattgtgca ggtaatggcatccctctcccgaatgtttcgagcaagatccttgctaaggttatagagtat tgcaagtaccatgtcgacgctcaaaaagtcacagaggataagacccaggaggaggagatc aagagctgggacgctgagtttgtcagggtcgatcaggccaccttgtttgatctcattctg gctgcaaactatctgaatatcaagaaccttctcgacctgacttgccaaactgtcgccgac atgatcaagggcaagactcctgaggagattaggaagaccttcaatattaagaacgatttc acaccagaggaagaggaagaggtcaggagggagaaccagtgggccttcgagtag

DBGET integrated database retrieval system