KEGG   Amborella trichopoda: 18438645Help
Entry
18438645          CDS       T02990                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
atr  Amborella trichopoda
Pathway
atr00564  Glycerophospholipid metabolism
atr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    18438645
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     18438645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox GIDA FAD_binding_3 Lycopene_cycl NAD_binding_8 HI0933_like Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-GeneID: 18438645
NCBI-ProteinID: XP_006848892
UniProt: W1PQY1
LinkDB All DBs
Position
Unknown
AA seq 628 aa AA seqDB search
MASVRLKAVAAVAAVGSSAWGILAVQDRALAESDHGSLENVRRRIHQSDGLVPSREVQES
ALKGSSSINPLDVLVVGGGATGCGVALDAATRGLRVGLVEREDFASGTSSRSTKLVHGGV
RYLEKAVFSLDYKQLKLVFHALEERKQVIENAPHLCQALPLMTPCFDWFEAVYYWMGLKL
YDLVAGPRMLHLSRYYSAQESIELFPTLAREGRGRSLKGTVVYYDGQMNDSRLNVGLACT
AALAGAAMLNYAEVISFHKDEATGRVIGARIRNNLSGKEFDTYAKVIVNAAGPFCDSVRK
LADKDAPLMICPSSGVHIILPDYYSPEGMGLIVPKTKDGRIAFMLPWLGKTIAGTTDSST
TITMLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLAIDPSAKNTESISRDHV
VSEEYPGLITITGGKWTTYRSMAEDAVDAAIKSGKLNPSGDCITSRLHIIGGDGWDPASF
TVLAQKFIRMKKTYGGKIVPGVMDSAVAKHLAHAYGSMADRVATIAQYENLGKRLAHGYP
YLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAANRALPRVIEILAAEHKWDRARKKQ
EIQKAKDFLETFKSSKNAQFHDGKHIGS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgtgaggctgaaagcggttgctgcagtggcagccgtcggatcatctgcatgg
ggaatcctcgctgttcaagatagggccttagcagagagtgaccatggaagcttagagaat
gtaaggagaagaattcatcaatcagatggtttggttccttcaagagaagtccaggaatct
gctttaaagggaagcagctccattaaccctcttgatgttcttgtggttggtgggggagcc
actggttgtggtgttgccctagatgctgcaactcgaggcttgagagtggggcttgtggag
agagaggattttgcatcagggacctcttctcgctctactaagttggttcatggaggagtg
cgctacttggaaaaggctgtctttagcttagattacaagcagctgaagttggttttccat
gcacttgaggagcgtaagcaggttatcgaaaatgctccacacttgtgccaagctttgcca
ttgatgactccatgttttgattggtttgaagccgtgtactactggatgggattgaaacta
tatgatttggttgctggccctcgaatgctgcatttgtctcgatattattctgcacaggag
tctatagagctctttccaactctggcaagagaaggtcgtggtagaagcttgaaagggaca
gttgtttactacgatggacaaatgaatgattctcgactaaatgttgggttggcttgcact
gctgcattagctggtgcggcaatgctcaattatgctgaagtgatatctttccacaaagat
gaggccactggtcgcgtaattggtgcacggatacgaaacaatttatctggaaaagaattc
gatacttatgctaaagttattgtcaatgcggcgggacccttttgtgattctgtgaggaaa
ttggcagacaaagatgctccacttatgatttgtcctagtagtggtgtacacataatcctt
cctgattattattctccagaaggaatgggcttaattgttccaaaaactaaggatggccgt
attgctttcatgctgccatggttgggaaaaaccattgcaggaactacagattctagtaca
acgataacaatgcttccagagcctcatgaagatgagatacagttcattctggacgccata
tgtgattaccttaatgtgaaggtacgccgtacagacgttctttccgcttggagtggtata
cgcccattggctattgatccatcagcaaaaaatactgagagcatttccagggatcatgtt
gtgagtgaagagtatcctggtctgatcacaattactgggggaaagtggactacctaccga
agtatggctgaagatgcagttgatgctgccataaaatctggcaaactcaacccatctggt
gactgtataaccagtcgtcttcacattattggaggagatggatgggatcctgcatcattc
actgtgcttgcacagaagtttatacgtatgaagaagacatatggtggtaaaattgttcca
ggtgtaatggacagtgcagtagccaaacatttggcacatgcatatggaagcatggctgat
cgtgtagccaccattgctcagtatgagaatctaggaaagagactagcacatggatatccc
tatctagaggctgaagtggcatattgtgctcgcaatgagtactgtgagtctgctgttgac
ttcattgcccggaggtctcggcttgcattccttgatacagatgctgccaatagagcgttg
ccacgtgtcatcgaaatattggctgcagagcacaagtgggacagggcacgaaagaagcag
gaaatacagaaagccaaagacttccttgaaaccttcaagtcttcgaagaatgcccaattc
catgatgggaaacacataggctcatga

DBGET integrated database retrieval system