KEGG   Amborella trichopoda: 18439292Help
Entry
18439292          CDS       T02990                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
atr  Amborella trichopoda
Pathway
atr00250  Alanine, aspartate and glutamate metabolism
atr00410  beta-Alanine metabolism
atr00430  Taurine and hypotaurine metabolism
atr00650  Butanoate metabolism
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    18439292
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    18439292
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    18439292
   00430 Taurine and hypotaurine metabolism
    18439292
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     18439292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 18439292
NCBI-ProteinID: XP_006849524
UniProt: W1PUY0
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MVISTAIADAGQALHCTFASRYVRTSLPRFKMPENSIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLILSTINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPVKEEEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPKKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWGTS
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGMVYPGIGWVIWRTKEDLPDEL
IFHINYLGADQPTFTLNFSKGASQIIAQYYQFIRLGFEGYRNIMGNCAENAKVLRGGLEK
TGRFEIISKEVGVPLVAFAFKDSKHNVFEISENLRRFGWIVPAYTMAPDAQHIAVLRVVV
REDFSRTLAERLLNDILRVLRELDELPPKTVQVKEATVQAADNSADGVVFKKSVRETQEE
ITRYWRRFVQGKKMNGVC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggttatcagcacggcgattgccgatgcaggccaggcccttcactgcacattcgcttcg
agatatgtccgcacgtctcttccgaggttcaagatgcctgagaattcgatcccgaaagat
gcggcttatcagattataaacgatgagttgatgcttgatgggaatccgaggctcaatttg
gcatcctttgttacgacatggatggaaccagagtgcgataaactcatcttgtccaccatt
aataagaactacgtcgacatggatgaataccctgtcaccactgagttacagaatagatgc
gtgaatattattgcccatctcttcaatgctccggtcaaggaagaggaggcggcagttgga
gttggaactgttgggtcttcggaagctataatgttggctgggctggcattcaagaggcag
tggcagaacaagagaaaagcggagggcaaaccttatgataaacccaacattgtaaccggt
gccaacgtgcaggtatgttgggagaaatttgctaggtattttgaggtggagttgaaggaa
gtgaagcttagagagggttactatgttatggacccaaaaaaggctgtggagatggtggat
gagaacacaatatgtgtggctgccatattaggttctactcttaatggtgaattcgaggat
gttaagcttctcaatgatctcttgacagagaaaaacaaggaaacaggttggggtacttct
attcatgtagatgcagctagtggagggttcattgcaccctttctctaccctgatttggaa
tgggatttcaggctgcccttggtgaagagcattaatgttagtggccacaagtatggcatg
gtttatccaggtattgggtgggtgatttggagaactaaggaagatttaccagatgaactc
atcttccatatcaattatttaggagcagaccaacccactttcacccttaatttttccaaa
ggtgccagtcagatcattgcacaatattaccagttcatacgcttgggctttgagggctat
cgaaacatcatggggaattgcgcagaaaatgccaaagtcttgaggggggggctagagaag
acaggccgattcgagatcatctcgaaggaggtgggggtgccacttgtggcttttgctttc
aaggacagcaagcacaatgtgtttgagatatctgaaaaccttcgaagatttggatggatt
gtgcctgcgtacactatggcccccgatgcccagcacattgctgtcttaagggtggtagtg
agagaggacttcagtcgaacgcttgccgaaaggttgcttaatgatatactgagggttttg
agagaattggatgaacttccgccgaaaacagtgcaggtgaaggaagccactgtgcaagct
gcagacaatagcgcagatggggtggtgttcaagaagagtgtaagagagacacaggaagag
attaccaggtattggaggaggtttgttcagggcaagaagatgaatggggtgtgctga

DBGET integrated database retrieval system